KEGG   Loxodonta africana (African savanna elephant): 100661620
Entry
100661620         CDS       T04351                                 

Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00500  Starch and sucrose metabolism
lav01100  Metabolic pathways
lav04970  Salivary secretion
lav04972  Pancreatic secretion
lav04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100661620
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    100661620
   04972 Pancreatic secretion
    100661620
   04973 Carbohydrate digestion and absorption
    100661620
Enzymes [BR:lav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100661620
SSDB
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Other DBs
NCBI-GeneID: 100661620
NCBI-ProteinID: XP_003409576
UniProt: G3U6H7
LinkDB
Position
Unknown
AA seq 534 aa
MMFYILVWDINSCWKEHCGLLSKMKFFLLLSAIAFCWAQYTPHTNPGGTSIVHLFEWRWA
DIALECERYLAPNGFGGVQVSPPSENAIINNPPRPWWERYQPISYKLCTRSGNEDEFKDM
VTRCNNVGVRIYADAVINHMCGSGVSAGTNSTCGSYFNPGSKDFPAVPYSHWDFNDGKCK
TGSGDIENYTDPYQVRDCRLVSLLDLALEKDYVRSKIAEYLNHLIDIGVAGFRIDASKHM
WPGDVKAILDKLHNLNTSWFPEGSKAFIYQEVIDMGGEPIKGSEYFGNGHVTEFKYGAKL
GTVLRKWNGEKMSYLKNWGEDWGFMPSDKAVVFVDNHDNQRGSGAGGASILTFWDSRLYK
MGVGFMLAHPYGFTRVMSSFHWPRYFENGKDVNAWVGPPNNDGEIKEVTINPDTTCGNDW
VCEHRWRQIKNMVAFRNVVDGQPFTNWWDNGSNQVAFGRGDKGFIVFNNDDWSLFVTLQT
GLPAGTYCDVISGDKSDSNCTGIKIYVSSDGKANFSISNSAEDPFIAIHADSKL
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgatgttctacatcctagtttgggatataaatagttgctggaaagaacactgtggactt
ctaagcaaaatgaagttctttctactactttcagccattgcattctgttgggctcagtat
accccacatacaaatcctggaggaacatctattgtccatctgtttgagtggcgctgggct
gatattgctcttgaatgtgagcgatacttagctcccaatggatttggaggggttcaggtt
tctccacccagtgaaaatgctataatcaataaccctccaagaccttggtgggaaagatac
caaccaattagctacaagttatgtacaagatctggaaatgaagatgaattcaaagacatg
gtgactagatgcaataacgttggtgttcgtatttatgcggatgctgtaattaatcatatg
tgtggaagtggtgtgagtgcaggaacaaacagcacttgcggaagttacttcaaccctgga
agtaaggattttccagcagtcccatactctcactgggattttaatgatggtaaatgtaaa
actggaagtggagatattgagaactatactgatccttatcaggtcagagattgtcgtctg
gttagtcttcttgatcttgctctggagaaagattatgtgcgttccaagattgctgagtat
ctgaaccacctcattgacattggtgtggcaggattcagaattgatgcttccaagcacatg
tggcctggagacgtgaaggcgattttggataaactgcataatctaaatacaagttggttc
cctgaaggaagtaaagctttcatttaccaggaggtaattgatatgggtggtgagccaatt
aaaggcagtgagtactttggaaatggccatgtgacagaattcaagtatggtgcaaaacta
ggcacagttctgcgcaagtggaatggagaaaagatgtcttacttgaagaactggggagaa
gactggggtttcatgccttctgacaaagcagttgtctttgtggataaccatgacaatcag
cgaggaagtggagctggaggagcatctattcttacattctgggactccagactgtataaa
atgggagttggatttatgcttgctcatccttatggatttacacgagtaatgtcaagtttc
cattggccaagatattttgagaatggaaaagatgttaatgcttgggtcgggccaccaaat
aatgatggcgaaattaaagaagttacaattaatccagacactacttgtggcaatgactgg
gtctgtgaacatcgatggcgtcaaataaagaacatggttgctttccgtaatgtagttgat
ggccagccttttacaaactggtgggataatggaagcaaccaagtggcttttggaagggga
gacaaaggatttattgtctttaacaatgatgactggtcattatttgtaactttgcaaact
ggtcttcctgctggcacatattgtgatgtcatttctggagataaaagtgacagcaactgc
acaggaattaaaatctatgtttccagtgatggcaaagctaacttttccattagcaactct
gctgaggatccatttattgcaattcatgctgactctaagttatga

KEGG   Loxodonta africana (African savanna elephant): 100661902
Entry
100661902         CDS       T04351                                 

Definition
(RefSeq) alpha-amylase 2B
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00500  Starch and sucrose metabolism
lav01100  Metabolic pathways
lav04970  Salivary secretion
lav04972  Pancreatic secretion
lav04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100661902
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    100661902
   04972 Pancreatic secretion
    100661902
   04973 Carbohydrate digestion and absorption
    100661902
Enzymes [BR:lav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100661902
SSDB
Motif
Pfam: Alpha-amylase_C Alpha-amylase LSR
Other DBs
NCBI-GeneID: 100661902
NCBI-ProteinID: XP_003409577
UniProt: G3UDW9
LinkDB
Position
Unknown
AA seq 511 aa
MKFFLLLLAVGFCWAQYSPHTESGRTSIVHLFEWRWADIALECERYLAPKGFGGVQVSPP
NENAVINNPSRPWWERYQPVSYKICTRSGNENEFKDMVTRCNNVGVRIYVDAVINHMSGS
GVSAGTSSTCGSYFDPGSRDFPAVPYSGWDFNDGKCKTESGEIENYQDATQVRDCRLVGL
VDLALGKDYVRSKIAEYLNNLIDIGVAGFRIDASKHMWPGDIKAILDTLNNLNTRWFSEG
SRAFIYQEVIDLGGEPITGSEYFGNGRVTEFKYGAKLGTVLRKWNGEKMSYLNNWGEGWG
FVPSDRALVFVDNHDNQRGHGAGGASILTFFDARLYKMGVGFMLAHPYGFTRVMSSYRWD
RNFVNGQDANDWIGPPNNDGVIKEVTINPDTTCGNGWVCEHRWRQIRNMVAFRNVVDGQP
FTNWWDNGSNQVAFGRGNKGFIVFNNDDWSLSVTLQTGLPAGTYCDVISGDKSDGNCTGI
KIYVSSDGKANFSISNSAEDPFIAIHADSKL
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgaagttctttctattacttttagctgttgggttctgctgggctcagtatagcccacat
actgaatctgggcgaacatctattgttcacctgtttgagtggcgctgggctgatattgcc
cttgaatgtgaacgatacttagctcccaaaggatttggaggcgttcaggtttctccaccc
aatgaaaatgctgtaatcaataacccttcaagaccttggtgggaaagataccaaccagtc
agctacaagatatgcacgagatctggaaatgaaaatgaattcaaagatatggtgactaga
tgcaacaacgttggtgtccgtatttacgtggatgctgtaattaatcatatgagtggaagt
ggcgtgagtgcaggaacaagcagtacttgtggaagttacttcgaccctggaagtagggat
tttccagcagtcccatactctggttgggattttaatgatggtaaatgtaaaactgaaagt
ggagaaattgagaactatcaagatgctactcaggtcagagattgtcgtctggttggtctt
gttgatcttgcattggggaaagattatgtgcggtccaagattgctgaatatctgaacaac
ctcattgacattggtgtggcaggattccgaattgatgcttccaagcacatgtggcctgga
gacataaaggctattttggatacactgaataatctaaacacacgctggttctccgaagga
agtcgagctttcatttaccaggaggtaattgatctgggtggtgaaccaattacaggcagt
gagtactttggaaatggccgtgtgacagaattcaagtatggtgcaaaactaggcacagtt
ctgcgcaagtggaatggagagaaaatgtcttacttaaacaactggggcgagggctggggt
tttgtgccttctgacagagcacttgtctttgtggataaccatgacaatcagcgaggacat
ggagctggcggagcatctattcttacattctttgatgctagactgtataaaatgggagtt
ggatttatgcttgctcatccttatggctttacacgagtaatgtcaagctaccgttgggac
agaaactttgtgaacggacaagatgctaatgattggattgggccaccaaataatgatgga
gtaattaaagaagttacaattaacccagacactacttgtggcaatggctgggtctgtgaa
catcgatggcgtcaaataaggaacatggttgctttccgaaatgtggttgatggccagcct
tttacaaattggtgggataatggaagcaaccaagtggcctttggaaggggaaacaaaggg
tttattgtctttaacaatgatgactggtcattatctgtaactttgcaaactggtcttcct
gctggcacatattgtgatgtcatttctggagataaaagtgacggcaactgcacaggaatt
aaaatctatgtttccagtgatggcaaagctaacttttccatcagcaactctgctgaggat
ccatttattgcaattcatgctgactccaagttatga

DBGET integrated database retrieval system