KEGG   Loxodonta africana (African savanna elephant): 100661626
Entry
100661626         CDS       T04351                                 

Gene name
PPP3CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04114  Oocyte meiosis
lav04218  Cellular senescence
lav04310  Wnt signaling pathway
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04380  Osteoclast differentiation
lav04625  C-type lectin receptor signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04720  Long-term potentiation
lav04724  Glutamatergic synapse
lav04728  Dopaminergic synapse
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04924  Renin secretion
lav05010  Alzheimer disease
lav05014  Amyotrophic lateral sclerosis
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05031  Amphetamine addiction
lav05152  Tuberculosis
lav05163  Human cytomegalovirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100661626 (PPP3CA)
   04310 Wnt signaling pathway
    100661626 (PPP3CA)
   04370 VEGF signaling pathway
    100661626 (PPP3CA)
   04020 Calcium signaling pathway
    100661626 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    100661626 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100661626 (PPP3CA)
   04218 Cellular senescence
    100661626 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100661626 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    100661626 (PPP3CA)
   04660 T cell receptor signaling pathway
    100661626 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    100661626 (PPP3CA)
   04659 Th17 cell differentiation
    100661626 (PPP3CA)
   04662 B cell receptor signaling pathway
    100661626 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100661626 (PPP3CA)
   04921 Oxytocin signaling pathway
    100661626 (PPP3CA)
   04924 Renin secretion
    100661626 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    100661626 (PPP3CA)
   04728 Dopaminergic synapse
    100661626 (PPP3CA)
   04720 Long-term potentiation
    100661626 (PPP3CA)
  09158 Development and regeneration
   04360 Axon guidance
    100661626 (PPP3CA)
   04380 Osteoclast differentiation
    100661626 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100661626 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100661626 (PPP3CA)
   05014 Amyotrophic lateral sclerosis
    100661626 (PPP3CA)
   05020 Prion disease
    100661626 (PPP3CA)
   05022 Pathways of neurodegeneration - multiple diseases
    100661626 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    100661626 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100661626 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100661626 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    100661626 (PPP3CA)
   05163 Human cytomegalovirus infection
    100661626 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100661626 (PPP3CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100661626 (PPP3CA)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100661626 (PPP3CA)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     100661626 (PPP3CA)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 100661626
NCBI-ProteinID: XP_010588774
LinkDB
Position
Unknown
AA seq 511 aa
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAM
PSDANLNSINKALASETNGTDSNGSNSSNIQ
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgtccgagcctaaggcaattgatcccaagttgtcgacgaccgacagggtggtgaaagct
gtcccatttcctccaagtcaccggcttacagcaaaagaagtgtttgataatgatgggaaa
cctcgtgtggatatcttaaaggcacatctcatgaaggagggccggctggaagagagtgtt
gcattgagaataataacagagggggcttcaattcttcgacaggaaaaaaacctgctggat
atagatgctcctgtcacagtttgtggggacatccatggacagttctttgacttgatgaag
ctctttgaagtggggggatctcctgccaacactcgctacctcttcttaggggactatgtt
gacagagggtacttcagtatcgaatgtgtgctctatttgtgggccttgaaaatcctttac
cccaaaacactgtttttacttcgtggaaatcatgaatgtagacatctaacagagtatttc
acatttaaacaagaatgtaaaataaagtattcggaacgtgtatacgatgcctgtatggat
gcctttgactgccttcctctggctgccctgatgaaccagcagttcctgtgtgtacacggt
ggtttgtctccagagattaacactttagacgatatcagaaaattagaccgattcaaagaa
ccacctgcttatggacctatgtgtgatatcctgtggtcagaccctctggaggattttgga
aatgagaagactcaggaacatttcactcacaacacagtcagggggtgttcatacttctac
agttacccggctgtatgtgaattcttacagcacaataacttgttatctatactccgagcc
catgaagcccaagatgcagggtatcgcatgtacaggaaaagccaaacaacaggcttccct
tctctaattacaattttttcagcaccaaattacttagacgtgtacaataacaaagctgca
gtattgaagtatgagaataatgttatgaacatcaggcaattcaactgttctcctcatcca
tactggcttccaaacttcatggatgttttcacttggtccctgccatttgttggagagaaa
gtgacggagatgctggtaaacgtcctcaatatctgctcagatgatgaactagggtcagaa
gaagatggatttgatggagcaacagcggcagcccggaaggaggtgataaggaacaagatc
cgagcaataggcaaaatggccagggtgttctcagttctcagagaagaaagtgagagtgtg
ctgacgctgaaaggcttgactccaacgggcatgctccccagcggagtgctttctggaggg
aagcaaaccctgcaaagcgctatcaaaggattttctccacaacataagatcactagcttc
gaggaggccaagggcttagaccgaattaacgagaggatgccgcctcgcagagatgctatg
ccctctgacgccaaccttaactccatcaacaaggccctcgcctcagagactaacggcacg
gacagcaatggcagtaatagcagcaatattcagtga

KEGG   Loxodonta africana (African savanna elephant): 100664832
Entry
100664832         CDS       T04351                                 

Gene name
PPP3CC
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04114  Oocyte meiosis
lav04218  Cellular senescence
lav04310  Wnt signaling pathway
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04380  Osteoclast differentiation
lav04625  C-type lectin receptor signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04720  Long-term potentiation
lav04724  Glutamatergic synapse
lav04728  Dopaminergic synapse
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04924  Renin secretion
lav05010  Alzheimer disease
lav05014  Amyotrophic lateral sclerosis
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05031  Amphetamine addiction
lav05152  Tuberculosis
lav05163  Human cytomegalovirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100664832 (PPP3CC)
   04310 Wnt signaling pathway
    100664832 (PPP3CC)
   04370 VEGF signaling pathway
    100664832 (PPP3CC)
   04020 Calcium signaling pathway
    100664832 (PPP3CC)
   04022 cGMP-PKG signaling pathway
    100664832 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100664832 (PPP3CC)
   04218 Cellular senescence
    100664832 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100664832 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    100664832 (PPP3CC)
   04660 T cell receptor signaling pathway
    100664832 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    100664832 (PPP3CC)
   04659 Th17 cell differentiation
    100664832 (PPP3CC)
   04662 B cell receptor signaling pathway
    100664832 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100664832 (PPP3CC)
   04921 Oxytocin signaling pathway
    100664832 (PPP3CC)
   04924 Renin secretion
    100664832 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    100664832 (PPP3CC)
   04728 Dopaminergic synapse
    100664832 (PPP3CC)
   04720 Long-term potentiation
    100664832 (PPP3CC)
  09158 Development and regeneration
   04360 Axon guidance
    100664832 (PPP3CC)
   04380 Osteoclast differentiation
    100664832 (PPP3CC)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100664832 (PPP3CC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100664832 (PPP3CC)
   05014 Amyotrophic lateral sclerosis
    100664832 (PPP3CC)
   05020 Prion disease
    100664832 (PPP3CC)
   05022 Pathways of neurodegeneration - multiple diseases
    100664832 (PPP3CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    100664832 (PPP3CC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100664832 (PPP3CC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100664832 (PPP3CC)
   05170 Human immunodeficiency virus 1 infection
    100664832 (PPP3CC)
   05163 Human cytomegalovirus infection
    100664832 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100664832 (PPP3CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100664832 (PPP3CC)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100664832 (PPP3CC)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     100664832 (PPP3CC)
SSDB
Motif
Pfam: Metallophos PTEN_C2 DUF5378
Other DBs
NCBI-GeneID: 100664832
NCBI-ProteinID: XP_010590696
LinkDB
Position
Unknown
AA seq 512 aa
MSGRSAQLSTTERVIKAVPFPPTQRLTLKEVFENGKPKIDVLKSHLVKEGRLEEEVALKI
IKDGAAILRQEKTMIEVDAPVTVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLYLWSLKINYPKTLFLLRGNHECRHLTEYFTFKQECRIKYSEEVYDACMDTFDC
LPLAALLNQQFLCVHGGMSPEITCLDDIKKLDRFKEPPAFGPVCDLLWSDPSEDYGSEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNILNICSDDELISDDESLEGGTTVRKEIIKNKIRAIGKMARVFSILREESESVLTLKG
LTPTGTLPLGVLSGGKQTIQTATVEAVEAREAIRGFSLQHKIRSFEEARGLDRINERMPP
RKDSVHPDGPVKLVTPVHPNAVHRSDPGKKTQ
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgtccgggaggagcgcccaactctccactacagaacgcgtcatcaaagccgttcccttt
cctccaactcaacggcttactttgaaggaagtatttgaaaatgggaaacctaaaattgac
gttttgaaaagccatttggtgaaggaaggccgactggaagaggaagtagccttgaagata
atcaaggatggggctgccatactgagacaagagaagactatgatagaagtagacgctcca
gtcacagtgtgtggtgacattcatggacagttctttgacctgatgaagctgtttgaagtt
ggaggatcacctagtaacacacgctacctctttctgggtgactatgtggatagaggctat
ttcagtatagagtgtgtgctctatttatggagtttaaagattaattatcccaaaacattg
tttctacttcgaggcaatcatgaatgcaggcatcttacagaatacttcaccttcaaacag
gaatgtcgaatcaaatattctgaagaggtgtatgatgcatgtatggatacatttgactgt
cttcctcttgctgcgctcttaaatcagcagtttctgtgtgtacatggagggatgtcaccg
gaaattacttgtttagatgacattaagaaattagacaggtttaaagaacctccagccttt
gggccagtgtgtgacctgctttggtctgatccctcagaggattatggcagtgaaaagacc
ttggagcactatacccacaacactgtccgaggatgctcttatttctacagctaccctgca
gtttgtgaatttttgcagaacaataatttgttgtcaataatcagagcccatgaagcccaa
gatgctgggtatcgaatgtacaggaagagccaaacaacaggctttccatcactcattaca
attttctctgccccgaattacctagatgtctataacaataaagctgctgtgctgaaatac
gaaaacaatgtcatgaatatcaggcagtttaactgttctccacacccttactggcttcca
aactttatggatgttttcacgtggtctttgccttttgttggagagaaagtcacagagatg
ctggttaacattctcaacatatgctctgatgatgaactaatttccgatgatgaatcctta
gaaggaggcacgacagtccgtaaggagatcatcaagaataaaatcagagccattgggaag
atggcacgagtcttttcaattcttcgggaagagagtgagagtgtgctgactctcaagggc
ctgactcctactggtacactccctctgggtgtcctctcaggaggaaagcagactattcag
acagccacagtagaagccgtagaggcccgggaagccatcagagggttttcgcttcagcac
aagatccggagttttgaagaagcccgaggtctggaccgaattaatgagcggatgccaccc
cgaaaagatagtgtacaccctgatgggccagtgaaattggtaacccctgtacatccaaac
gctgtacacaggagcgacccagggaagaaaacccagtag

KEGG   Loxodonta africana (African savanna elephant): 100668807
Entry
100668807         CDS       T04351                                 

Gene name
PPP3R2
Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04114  Oocyte meiosis
lav04218  Cellular senescence
lav04310  Wnt signaling pathway
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04380  Osteoclast differentiation
lav04625  C-type lectin receptor signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04720  Long-term potentiation
lav04724  Glutamatergic synapse
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04924  Renin secretion
lav05010  Alzheimer disease
lav05014  Amyotrophic lateral sclerosis
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05031  Amphetamine addiction
lav05152  Tuberculosis
lav05163  Human cytomegalovirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100668807 (PPP3R2)
   04310 Wnt signaling pathway
    100668807 (PPP3R2)
   04370 VEGF signaling pathway
    100668807 (PPP3R2)
   04020 Calcium signaling pathway
    100668807 (PPP3R2)
   04022 cGMP-PKG signaling pathway
    100668807 (PPP3R2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100668807 (PPP3R2)
   04218 Cellular senescence
    100668807 (PPP3R2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100668807 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    100668807 (PPP3R2)
   04660 T cell receptor signaling pathway
    100668807 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    100668807 (PPP3R2)
   04659 Th17 cell differentiation
    100668807 (PPP3R2)
   04662 B cell receptor signaling pathway
    100668807 (PPP3R2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100668807 (PPP3R2)
   04921 Oxytocin signaling pathway
    100668807 (PPP3R2)
   04924 Renin secretion
    100668807 (PPP3R2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100668807 (PPP3R2)
   04720 Long-term potentiation
    100668807 (PPP3R2)
  09158 Development and regeneration
   04360 Axon guidance
    100668807 (PPP3R2)
   04380 Osteoclast differentiation
    100668807 (PPP3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100668807 (PPP3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100668807 (PPP3R2)
   05014 Amyotrophic lateral sclerosis
    100668807 (PPP3R2)
   05020 Prion disease
    100668807 (PPP3R2)
   05022 Pathways of neurodegeneration - multiple diseases
    100668807 (PPP3R2)
  09165 Substance dependence
   05031 Amphetamine addiction
    100668807 (PPP3R2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100668807 (PPP3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100668807 (PPP3R2)
   05170 Human immunodeficiency virus 1 infection
    100668807 (PPP3R2)
   05163 Human cytomegalovirus infection
    100668807 (PPP3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100668807 (PPP3R2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100668807 (PPP3R2)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100668807 (PPP3R2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9
Other DBs
NCBI-GeneID: 100668807
NCBI-ProteinID: XP_003407876
LinkDB
Position
Unknown
AA seq 170 aa
MGNEASYPAEMCSHFDQDEIKRLGKRFKKLDLDKSGSLSVEEFLSMPELRYNPLLRRVID
IFDTDGSGEVDFKEFIVGASQFSVKGNEEQKLRFAFNIYDMDKDGYISNGELFQVLRMMV
GSNLKDWQLQQLVDKTIIILDRDGDGKISFEEFSAVVRGLEIHKKLVLIV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaacgaggcgagttaccccgcggagatgtgctcccactttgaccaggatgaaatt
aaaaggctgggaaagcgcttcaaaaagctggacttggacaagtcgggctcgctgagcgtg
gaggagttcctgtccatgcccgagctgcggtacaaccccttgctgcggcgagtgatcgac
atcttcgacaccgacgggagtggcgaagtggacttcaaggaattcatcgtgggggcttcc
caattcagtgtcaaaggaaacgaggagcagaaattgaggtttgctttcaacatctacgac
atggataaagacggctacatttccaacggcgagctcttccaggtgttgaggatgatggtg
gggagcaacctgaaagactggcagttacagcagcttgtggacaaaaccatcatcatcctg
gacagggatggcgacgggaaaatatccttcgaggagttctctgctgtggtccggggcctg
gagatccacaagaagctggtgctaattgtgtga

KEGG   Loxodonta africana (African savanna elephant): 100677352
Entry
100677352         CDS       T04351                                 

Gene name
PPP3CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04114  Oocyte meiosis
lav04218  Cellular senescence
lav04310  Wnt signaling pathway
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04380  Osteoclast differentiation
lav04625  C-type lectin receptor signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04720  Long-term potentiation
lav04724  Glutamatergic synapse
lav04728  Dopaminergic synapse
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04924  Renin secretion
lav05010  Alzheimer disease
lav05014  Amyotrophic lateral sclerosis
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05031  Amphetamine addiction
lav05152  Tuberculosis
lav05163  Human cytomegalovirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100677352 (PPP3CB)
   04310 Wnt signaling pathway
    100677352 (PPP3CB)
   04370 VEGF signaling pathway
    100677352 (PPP3CB)
   04020 Calcium signaling pathway
    100677352 (PPP3CB)
   04022 cGMP-PKG signaling pathway
    100677352 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100677352 (PPP3CB)
   04218 Cellular senescence
    100677352 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100677352 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    100677352 (PPP3CB)
   04660 T cell receptor signaling pathway
    100677352 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    100677352 (PPP3CB)
   04659 Th17 cell differentiation
    100677352 (PPP3CB)
   04662 B cell receptor signaling pathway
    100677352 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100677352 (PPP3CB)
   04921 Oxytocin signaling pathway
    100677352 (PPP3CB)
   04924 Renin secretion
    100677352 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    100677352 (PPP3CB)
   04728 Dopaminergic synapse
    100677352 (PPP3CB)
   04720 Long-term potentiation
    100677352 (PPP3CB)
  09158 Development and regeneration
   04360 Axon guidance
    100677352 (PPP3CB)
   04380 Osteoclast differentiation
    100677352 (PPP3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100677352 (PPP3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100677352 (PPP3CB)
   05014 Amyotrophic lateral sclerosis
    100677352 (PPP3CB)
   05020 Prion disease
    100677352 (PPP3CB)
   05022 Pathways of neurodegeneration - multiple diseases
    100677352 (PPP3CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    100677352 (PPP3CB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100677352 (PPP3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100677352 (PPP3CB)
   05170 Human immunodeficiency virus 1 infection
    100677352 (PPP3CB)
   05163 Human cytomegalovirus infection
    100677352 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100677352 (PPP3CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100677352 (PPP3CB)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100677352 (PPP3CB)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     100677352 (PPP3CB)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 100677352
NCBI-ProteinID: XP_023402838
LinkDB
Position
Unknown
AA seq 511 aa
MSVVIYLLLITKISAVPFPPTHRLTSEEVFDMDGIPRVDVLKNHLVKEGRVDEEIALRII
NEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYF
SIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSL
PLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQ
EHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITI
FSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEML
VNVLSICSDDELMTEGEDQFDVGSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLK
GLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMP
PRKDAVQQDGFNSLNTAHATENHGTGNHSAQ
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgtcagtagtgatttatcttttattaattacgaaaatttcagctgtcccgttcccccca
acacatcgcttgacatctgaagaagtatttgatatggatgggatacccagggttgatgtt
ctgaagaaccatttagtaaaagaaggtcgggtagatgaagaaattgcacttagaattatc
aatgagggtgctgccatccttcggagagagaaaaccatgatagaagtagaagctccaatt
acagtgtgtggtgacatccatggccaattttttgatctgatgaaactttttgaagtggga
ggatcacctgctaatacacgatacctttttcttggtgattatgtggacagaggttatttt
agtatagagtgtgtcttatacttatgggtcctgaagattctatacccaagcacattattt
cttctgagaggcaaccatgaatgcagacaccttactgaatattttacctttaagcaggaa
tgtaaaattaaatattcagaaagagtctatgaagcttgtatggaagcattcgatagcctg
cctcttgctgcacttttaaaccaacagtttctttgtgttcatggtggactttcaccagaa
atacacacactggatgatattaggagattagatagattcaaagagccacctgcatttgga
ccaatgtgtgacttgctatggtccgatccctctgaagattttggaaatgaaaaatcacag
gaacattttagtcacaatacagttcgaggatgttcttatttttataactatccagcagtg
tgtgaatttttgcaaaacaataatttgttatcgattattagagctcatgaagctcaagat
gcaggctatagaatgtacagaaaaagtcaaactacagggttcccttcattaataacaatt
ttttcggcacctaattacttagatgtctacaataataaagctgctgtattaaagtatgaa
aataatgtgatgaatattcgacagtttaattgttcaccacatccttactggttgcccaat
tttatggatgtcttcacatggtctttaccatttgttggagaaaaagtgacagaaatgttg
gtaaatgttctcagtatttgctctgatgatgaactaatgaccgaaggtgaagaccagttt
gatgtaggttcagctgcagcacggaaagaaatcataagaaacaaaattcgagcaattggc
aagatggcaagggtcttctctgttctcagggaggagagtgaaagcgtgctgacactcaag
ggcctgactcccacagggatgttgcctagtggagtgttagctggaggacggcagaccctg
caaagtgccacagttgaggcaattgaggctgaaaaagcaatacgaggattctctccacca
catagaatctgcagttttgaagaggcaaagggtttggataggatcaatgagagaatgcca
ccccggaaagatgctgtacagcaagatggtttcaattctctgaacaccgcacatgccact
gagaaccacgggactggcaaccatagtgcccagtga

KEGG   Loxodonta africana (African savanna elephant): 111751572
Entry
111751572         CDS       T04351                                 

Gene name
PPP3R1
Definition
(RefSeq) calcineurin subunit B type 1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04114  Oocyte meiosis
lav04218  Cellular senescence
lav04310  Wnt signaling pathway
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04380  Osteoclast differentiation
lav04625  C-type lectin receptor signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04720  Long-term potentiation
lav04724  Glutamatergic synapse
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04924  Renin secretion
lav05010  Alzheimer disease
lav05014  Amyotrophic lateral sclerosis
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05031  Amphetamine addiction
lav05152  Tuberculosis
lav05163  Human cytomegalovirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111751572 (PPP3R1)
   04310 Wnt signaling pathway
    111751572 (PPP3R1)
   04370 VEGF signaling pathway
    111751572 (PPP3R1)
   04020 Calcium signaling pathway
    111751572 (PPP3R1)
   04022 cGMP-PKG signaling pathway
    111751572 (PPP3R1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111751572 (PPP3R1)
   04218 Cellular senescence
    111751572 (PPP3R1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111751572 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    111751572 (PPP3R1)
   04660 T cell receptor signaling pathway
    111751572 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    111751572 (PPP3R1)
   04659 Th17 cell differentiation
    111751572 (PPP3R1)
   04662 B cell receptor signaling pathway
    111751572 (PPP3R1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    111751572 (PPP3R1)
   04921 Oxytocin signaling pathway
    111751572 (PPP3R1)
   04924 Renin secretion
    111751572 (PPP3R1)
  09156 Nervous system
   04724 Glutamatergic synapse
    111751572 (PPP3R1)
   04720 Long-term potentiation
    111751572 (PPP3R1)
  09158 Development and regeneration
   04360 Axon guidance
    111751572 (PPP3R1)
   04380 Osteoclast differentiation
    111751572 (PPP3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111751572 (PPP3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111751572 (PPP3R1)
   05014 Amyotrophic lateral sclerosis
    111751572 (PPP3R1)
   05020 Prion disease
    111751572 (PPP3R1)
   05022 Pathways of neurodegeneration - multiple diseases
    111751572 (PPP3R1)
  09165 Substance dependence
   05031 Amphetamine addiction
    111751572 (PPP3R1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111751572 (PPP3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111751572 (PPP3R1)
   05170 Human immunodeficiency virus 1 infection
    111751572 (PPP3R1)
   05163 Human cytomegalovirus infection
    111751572 (PPP3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111751572 (PPP3R1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    111751572 (PPP3R1)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     111751572 (PPP3R1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 111751572
NCBI-ProteinID: XP_023408480
LinkDB
Position
Unknown
AA seq 170 aa
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggcaagttaccctttggaaatgtgctcacactttgacgctgatgagatc
aaaaggctaggaaagagatttaagaagcttgatttggacaattctggttctttgagtgtg
gaagagttcatgtccttgccagagttacaacagaatcctttagtgcagcgagtaatagac
atatttgacacagatgggaacggagaagtagactttaaagaattcattgagggagtgtct
cagttcagtgtcaaaggagacaaggaacagaagttgaggtttgctttccgtatctatgac
atggataaagatggctatatttcgaatggggaactcttccaggtgctgaagatgatggtg
gggaacaatctgaaagatacacaattacagcaaattgtagacaaaaccataataaatgca
gataaggatggagatggaagaatatcctttgaagaattttgtgctgttgtaggtggccta
gatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system