KEGG   Loxodonta africana (African savanna elephant): 100661726
Entry
100661726         CDS       T04351                                 

Gene name
MAD2L2
Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD2B isoform X1
  KO
K13728  mitotic spindle assembly checkpoint protein MAD2B
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04914  Progesterone-mediated oocyte maturation
lav05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100661726 (MAD2L2)
   04114 Oocyte meiosis
    100661726 (MAD2L2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100661726 (MAD2L2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100661726 (MAD2L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100661726 (MAD2L2)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     100661726 (MAD2L2)
SSDB
Motif
Pfam: HORMA
Other DBs
NCBI-GeneID: 100661726
NCBI-ProteinID: XP_003413214
UniProt: G3TGM9
LinkDB
Position
Unknown
AA seq 211 aa
MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPEL
NQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVE
QLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVH
MHDPRLIPLKTMTSDILKMQLYVEERAHKSS
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaccacgcttacgcggcaggacctcaactttggccaagtggtggccgatgtgctctgt
gagttcctggaggtagcagtgcacctgatcctctatgtgagagaagtctacccggtgggg
atcttccagaaacgcaagaagtacaacgtgccggtccagatgtcctgccacccggagctg
aaccagtatattcaggatacgctgcactgcgtcaagccactcctggagaagaatgatgtc
gagaaagtggtggtggtgattttggataaagagcaccgcccagtggagaaattcgtcttt
gaaatcactcagcctcccttgctgtccatcagttcagactccctgctgtctcacgtggag
cagctgctccgagccttcatcctgaagatcagtgtgtgtgatgctgtcctggaccacaac
cccccaggctgtaccttcacagtcctggtgcacacgagagaagcagccactcgcaacatg
gagaagatccaggtcatcaaggacttcccctggatcctggcagatgaacaggatgtccac
atgcatgacccccggctaatacccctgaagaccatgacgtcagacattttaaagatgcag
ctctatgtggaagagcgagctcacaaaagcagctga

KEGG   Loxodonta africana (African savanna elephant): 100667589
Entry
100667589         CDS       T04351                                 

Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD2A-like
  KO
K02537  mitotic spindle assembly checkpoint protein MAD2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04914  Progesterone-mediated oocyte maturation
lav05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100667589
   04114 Oocyte meiosis
    100667589
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100667589
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100667589
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100667589
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     100667589
SSDB
Motif
Pfam: HORMA ATG101 bacHORMA_2
Other DBs
NCBI-GeneID: 100667589
NCBI-ProteinID: XP_003410468
UniProt: G3TWF5
LinkDB
Position
Unknown
AA seq 205 aa
MALQLTREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDPE
LIKYLNNVVEQLKEWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAARAKS
QKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEE
VRLRSFTTTIHKVNSMVAYKIPVND
NT seq 618 nt   +upstreamnt  +downstreamnt
atggccctgcagctcacccgggagcagggtattaccctccgcggaagcgccgaaatcgtg
gccgagttcttctcatttggcattaacagcattttatatcagcgtggcatatatccatct
gaaacctttactcgagtacaaaaatatggactcaccttgcttgtgactactgatcctgaa
ctcatcaaatacctaaataatgtggtggaacaactaaaagaatggttatacaaatgttct
gttcagaaactggtggtagtcatctcaaatattgaaagtggtgaggtccttgaaagatgg
cagtttgatattgagtgtgacaagactgcaaaagatgacagtgcagccagagcaaagtct
cagaaagctatccaagatgagatccgttcagtgatcagacagatcacggctacagtaaca
tttctgccgctgttggaagtttcctgttcatttgatctactgatttacacagataaagat
ttggttgtacctgagaaatgggaagaatcaggaccacagttcattaccaattctgaggaa
gtccgtcttcgttcattcactactacaatccacaaagtaaatagcatggtggcctacaaa
attcctgtcaatgactga

KEGG   Loxodonta africana (African savanna elephant): 100668722
Entry
100668722         CDS       T04351                                 

Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD2A isoform X1
  KO
K02537  mitotic spindle assembly checkpoint protein MAD2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04914  Progesterone-mediated oocyte maturation
lav05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100668722
   04114 Oocyte meiosis
    100668722
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100668722
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100668722
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100668722
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     100668722
SSDB
Motif
Pfam: HORMA ATG101 bacHORMA_2 ATG13
Other DBs
NCBI-GeneID: 100668722
NCBI-ProteinID: XP_003410469
UniProt: G3TM64
LinkDB
Position
Unknown
AA seq 205 aa
MALQLTREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDPE
LIKYLNNVVEQLKEWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAAREKS
QKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEE
VRLRSFTTTIHKVNSMVAYKIPVND
NT seq 618 nt   +upstreamnt  +downstreamnt
atggcgctgcagctcacccgggagcagggtattaccctccgcgggagcgccgaaatcgtg
gccgagttcttctcatttggcattaacagcattttatatcagcgtggcatatatccatct
gaaacctttactcgagtgcaaaaatatggactcaccttgcttgtgactacagatcctgaa
ctcatcaaatatctgaataatgtggtggaacaactaaaagaatggttatacaaatgttct
gttcagaaactggtggtagtcatctcaaatattgaaagtggtgaggtccttgaaagatgg
cagtttgatattgagtgtgacaagactgcaaaagatgacagtgcagccagagaaaagtct
cagaaagctatccaagatgagatccgttcagtgatcagacagatcacagctacagtaaca
tttctgccgctgttggaagtttcctgttcgtttgatctactgatttacacagataaagat
ttggttgtacctgagaaatgggaagaatcaggaccacagttcattaccaattctgaggaa
gtccgtcttcgttcattcactactacaatccacaaagtaaatagcatggtggcctacaaa
attcctgtcaatgactga

KEGG   Loxodonta africana (African savanna elephant): 100675028
Entry
100675028         CDS       T04351                                 

Gene name
MAD1L1
Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD1 isoform X3
  KO
K06679  mitotic spindle assembly checkpoint protein MAD1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04914  Progesterone-mediated oocyte maturation
lav05166  Human T-cell leukemia virus 1 infection
lav05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100675028 (MAD1L1)
   04114 Oocyte meiosis
    100675028 (MAD1L1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100675028 (MAD1L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100675028 (MAD1L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100675028 (MAD1L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100675028 (MAD1L1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     100675028 (MAD1L1)
SSDB
Motif
Pfam: MAD TSC22 DUF4200
Other DBs
NCBI-GeneID: 100675028
NCBI-ProteinID: XP_003416543
LinkDB
Position
Unknown
AA seq 717 aa
MEDLGENTTVLSSLRSLNNFISQRVEGGPGLDVCTSVPGSLQMQYQQSMQLEERAEQIRS
QSHLIQVEREKMQMELSHKRARVELERAATTSARNYEREVDRNQELLTRIRQLQEHEAEA
AEKMKEQLERNRACRQNLDAANKKLREKEDSLAEASETISTLKGRISELQWSTMNQEMQV
KGLESEKQELKEQLDAQHRKWQEANQKIQDLQASQEVRVDHEQKIKDLEQKLCLQEQDAA
VVKNMKSELVRLPKVERELRQLREENVRLREVRETHGLLQEEVEGLQRRLGRQEKLQEEL
VGLELEKERLLGKLQSWERLDQTTGLHIRTPEDLSRFIVELQQRELTLKEKNSSITSSAR
GLEKARQQLQDEVRQVGSQLLEERKRRETSEALARRLQKRVLLLTKDRTGMRAILGSYDS
ELTPAEYSPQLTRRIREAEDMVQKVHAHSSEIEAQLSQALEELGDQKQRADTLEMELKLL
KSQADPADQSFLFSREEVDTLRLKIEELEGERRRLEEEKKTLEMQLEKLTLQGDYDQSRT
KVLHLRMNPASAARQRLRENQVQLQEECERLRELVHTLERGGAVPADLEGTAGLPSAKEV
AELKKQVESAELKNQRLKEVFQTKIQEFRKVCYTLTGYQIDITTENQYRLTSMYAEHKAD
CLLFKATGPSGAKMQLLETEFSRTVGELIELHLLRQDSIPAFLSSLTLDLFSRQTVA
NT seq 2154 nt   +upstreamnt  +downstreamnt
atggaagacctgggggaaaacaccactgttctgtcctccctgagatcgttgaacaacttc
atttctcagcgagtggagggtgggcctggactggatgtctgcacctctgtgccaggctct
ctgcagatgcagtaccagcagagcatgcagctggaggagcgagccgagcagatccgctcc
cagtctcacctcatccaggtggagcgggagaagatgcagatggagctgagccacaagcgg
gcccgtgtggagctggagcgcgcggccaccaccagtgcccggaactacgagcgcgaggtt
gaccgcaaccaggagctactgacacgtatccggcaactgcaagagcacgaggctgaggca
gcggagaagatgaaggagcagctggagcgcaaccgggcatgccggcagaacttggatgct
gccaacaagaaactgcgggagaaggaggacagcctggccgaggccagcgagaccattagc
acgttgaagggcaggatctcagagctgcagtggagcacgatgaaccaggagatgcaggtg
aagggcctggagtctgagaagcaggagctgaaggagcagctggatgcacagcacagaaaa
tggcaggaggcgaatcagaagatccaggatctgcaggccagccaggaagtgagagtggat
catgagcagaagatcaaggacttggagcagaagctatgccttcaggagcaggatgctgct
gtggtgaagaacatgaagtcagagctggtgcggctccccaaagtggagcgggagctgagg
cagctgcgggaggagaatgttcgcctgcgggaggtgagagagacccacgggctgctccag
gaggaggtggaagggctgcagaggcggctggggcggcaggagaagctgcaggaggagctg
gtcggcctggagctggagaaggagaggctgctggggaagctgcagagctgggagaggctg
gaccagaccacaggcttgcacatcaggaccccagaggacctctccaggtttattgtggaa
ttgcagcagagagagcttaccctgaaggagaagaacagctccatcaccagcagtgcccgc
gggctggagaaggcacgacagcagcttcaggacgaggtccgccaggtgggcagccagttg
ctggaggagcgcaagcggcgtgagacaagcgaggccctggctcggaggctgcagaagcgt
gtgctgctgctgaccaaggatagaacgggcatgcgggccatcctgggttcctatgacagt
gagctgaccccagcggagtactcaccgcagctgacacgccgcatccgcgaggctgaagac
atggtgcagaaggtacacgcccacagctccgagatcgaggctcagctgtcgcaggcccta
gaagagctgggagaccagaagcagagagcggacacgctggagatggagctgaagctcttg
aagtcccaggcagaccctgctgaccagagcttcttgttctccagggaggaagtagacacg
ctcagattaaagatcgaggagctggagggagagcggagacgtctggaggaagaaaagaag
acgctcgagatgcagctggagaagctcaccctgcagggtgactatgaccagagccggacc
aaggtgctgcacctgcgcatgaacccggccagtgcggcccggcagcggctccgtgagaac
caggtgcagctgcaggaggagtgtgagcggctgcgcgagctggtgcacaccttggagcgg
ggcggcgctgtccccgctgacctcgaaggcactgcaggtctgccgtctgccaaggaggtg
gcagagctgaagaagcaggtggaaagtgccgagctgaaaaaccagcggctgaaggaagtc
ttccaaaccaagatccaggagttccggaaagtctgctacacactcacgggctaccagatt
gacatcaccactgagaaccagtaccgtctgacgtccatgtacgccgagcacaaggccgac
tgcctgctcttcaaggccacaggaccctcgggggccaagatgcagctgctggagacagag
ttctcccgcacagtcggcgagctcatcgagctgcacctgctgcgccaggacagcatccca
gccttcctcagctccctcaccctcgacctcttcagccgccagaccgtggcctag

DBGET integrated database retrieval system