KEGG   Loxodonta africana (African savanna elephant): 100661828
Entry
100661828         CDS       T04351                                 

Gene name
PCNA
Definition
(RefSeq) proliferating cell nuclear antigen
  KO
K04802  proliferating cell nuclear antigen
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03030  DNA replication
lav03410  Base excision repair
lav03420  Nucleotide excision repair
lav03430  Mismatch repair
lav04110  Cell cycle
lav04530  Tight junction
lav05161  Hepatitis B
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100661828 (PCNA)
   03410 Base excision repair
    100661828 (PCNA)
   03420 Nucleotide excision repair
    100661828 (PCNA)
   03430 Mismatch repair
    100661828 (PCNA)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100661828 (PCNA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100661828 (PCNA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100661828 (PCNA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lav03032]
    100661828 (PCNA)
   03400 DNA repair and recombination proteins [BR:lav03400]
    100661828 (PCNA)
DNA replication proteins [BR:lav03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    100661828 (PCNA)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100661828 (PCNA)
   MMR (mismatch excision repair)
    Other MMR factors
     100661828 (PCNA)
  TLS (translesion DNA synthesis) factors
   Other TLS factors
    100661828 (PCNA)
SSDB
Motif
Pfam: PCNA_C PCNA_N Rad1 Rad9 Hus1 FmdE
Other DBs
NCBI-GeneID: 100661828
NCBI-ProteinID: XP_003411475
UniProt: G3SY50
LinkDB
Position
Unknown
AA seq 261 aa
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI
KLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSSDVPLVVEYK
IADMGHLKYYLAPKIEDEEAS
NT seq 786 nt   +upstreamnt  +downstreamnt
atgttcgaggcgcgcttggtccagggctccatcctgaagaaggtgctggaggcgctcaag
gacctcatcaacgaggcctgctgggacatcagctcgagcggagtgaacctgcagagtatg
gactcgtcccacgtctccttggtgcagctcaccctgcgctccgagggcttcgacacctac
cgctgtgaccgcaacttggccatgggcgtgaatctcaccagcatgtccaaaatactaaaa
tgtgctggcaatgaagatatcattacactaagggctgaagataatgcggataccttggca
ctcgtatttgaagcgccaaaccaagaaaaagtttcagactatgaaatgaagctaatggat
ttagacgttgaacaacttggaattccagaacaggagtatagctgtgtagtaaagatgcct
tctggtgaatttgcacgtatatgccgagatctaagtcatattggagatgctgttgtcatt
tcctgtgcaaaagatggagtgaaattttctgcaagtggagaacttgggaatggaaacatt
aaattgtcacaaacaagtaatgtcgataaggaggaagaggctgttaccatagagatgaat
gagccagttcagctaacttttgcacttaggtacctgaacttctttacaaaagccactcca
ctctcttctaccgtaacactcagtatgtcttcagatgtgccccttgttgtagagtataaa
attgctgatatgggacacttaaagtactatttggctcccaagatcgaggatgaagaagca
tcttag

DBGET integrated database retrieval system