KEGG   Loxodonta africana (African savanna elephant): 100661836
Entry
100661836         CDS       T04351                                 

Gene name
CTNNA2
Definition
(RefSeq) catenin alpha-2 isoform X3
  KO
K05691  catenin alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04390  Hippo signaling pathway
lav04520  Adherens junction
lav04670  Leukocyte transendothelial migration
lav05100  Bacterial invasion of epithelial cells
lav05200  Pathways in cancer
lav05213  Endometrial cancer
lav05226  Gastric cancer
lav05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100661836 (CTNNA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100661836 (CTNNA2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100661836 (CTNNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100661836 (CTNNA2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100661836 (CTNNA2)
   05213 Endometrial cancer
    100661836 (CTNNA2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100661836 (CTNNA2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100661836 (CTNNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100661836 (CTNNA2)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100661836 (CTNNA2)
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 100661836
NCBI-ProteinID: XP_003413756
LinkDB
Position
Unknown
AA seq 905 aa
MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVL
AASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKR
GTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFG
KEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANR
DYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAALNEFDNKIILDPMTFSEARFR
PSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMNNTGRKEKGD
PLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQV
FREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQD
NMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTA
GAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANV
PQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDD
QLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCM
IMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQ
RIALYCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASYVAST
KYQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFK
AMDSF
NT seq 2718 nt   +upstreamnt  +downstreamnt
atgacttcggcaacttcacctatcattttgaaatgggaccccaaaagtttggaaatcagg
actttaacagtggagaggctgctggaaccacttgttacacaggtgacgacccttgtcaac
acaagcaacaaaggcccgtctggtaaaaagaaagggaggtctaagaaagcccatgtacta
gctgcttctgtagagcaggccactcagaacttcctggaaaagggggaacagattgctaag
gagagccaagatctcaaggaagaattggttgctgctgtagaggatgttcgaaaacaaggt
gagacgatgaggattgcttcttcggagtttgctgatgacccgtgctcctcggtgaagcgt
ggcactatggtgcgggcagcaagggctttgctctcagcagttacacgccttcttatcctg
gcagatatggcggatgttatgagacttttatcacatctgaaaattgtggaggaggccctg
gaagccgtcaaaaacgctacaaatgagcaagacctcgcaaatcgctttaaagagtttgga
aaagagatggtgaaacttaactacgtagcagcaaggagacagcaggagctgaaggaccct
cactgtcgggatgagatggcagctgcccgaggagctctcaagaagaatgccacaatgctg
tatacagcctcgcaagcgtttctccgccacccagatgtggctgccacaagagccaaccga
gattatgtgttcaaacaagtccaggaagccattgctggcatctccaatgctgcccaagct
acctcgcccactgacgaagccaaaggccacacaggcattggtgagctggccgcggctctg
aatgagtttgacaacaagattatcctcgaccccatgacgttcagcgaggcccggttccgg
ccgtccctggaggagaggctggagagcatcatcagtggcgcggcgctgatggccgactcg
tcctgcacgcgcgacgaccggcgcgagaggatcgtggccgagtgcaacgcggtgcggcag
gcgctgcaggacctgctcagcgagtacatgaataacactggaaggaaagaaaaaggagat
cctctaaacattgcaattgataagatgaccaagaaaacaagagatctaaggagacagctt
cggaaagcagtgatggatcacatatccgattctttcttggaaaccaacgtccctttgtta
gttctcattgaagctgcaaagagtgggaatgaaaaggaagtgaaagaatatgcccaggtt
ttccgtgagcatgccaataagctggtggaggttgccaacttggcctgttccatatccaac
aatgaggaaggggtgaaattagtccggatggcagccacccagattgacagtctgtgtccc
caggtcatcaatgctgctctcacactggctgcccggccacaaagcaaagttgctcaggat
aacatggatgtcttcaaggaccagtgggagaagcaggtccgagtcctgaccgaggccgtg
gatgacatcacctcggtggatgatttcctctctgtctcagaaaatcacatcttggaggat
gtgaacaagtgtgtgatagccctccaagagggagatgtggacaccctggaccggacagcg
ggggccatcagaggccgggcagcccgagtcatccacatcatcaatgctgagatggagaac
tatgaagctggggtttatactgagaaggtgctagaagctacaaaattgctctctgagaca
gtgatgccacgctttgctgaacaagtagaggttgccattgaagccctgagtgccaacgtc
cctcagccgtttgaggagaatgaattcatcgatgcctctcgcctggtatatgacggtgtt
cgggacatcagaaaggctgtgctgatgatcaggacaccagaagaactagaggacgattct
gacttcgaacaggaagattatgatgtacgcagccgaacaagtgtccagactgaagatgac
cagctcattgcagggcagagtgcacgggccatcatggcgcaactaccccaggaggagaag
gcaaagatagctgagcaggtggagatcttccaccaagagaaaagcaagctggatgctgaa
gtggctaaatgggatgacagtggcaatgatatcattgtattggccaagcagatgtgcatg
atcatgatggagatgacggacttcaccagaggcaaaggcccattgaaaaacacatctgat
gtcattaatgctgccaagaaaattgctgaagcaggttctcgaatggacaaattggcccgt
gctgtggctgatcagtgtcctgattcagcatgtaagcaggatttattagcctaccttcaa
cgaattgccttgtattgccatcagctcaatatctgcagcaaggtgaaggcagaagtacag
aatctgggaggagagctcattgtatcagggctggacagtgccacatcactcatccaggca
gctaaaaacctgatgaacgccgtcgtcctcacagtgaaagcatcctatgtggcttcgacc
aaataccagaaggtctatgggacagcagctgtcaactcacctgttgtgtcttggaagatg
aaggctccagagaagaagcccctcgtgaagagagaaaaacctgaagaattccagacgcga
gttagacggggttctcagaagaaacacatttcgcctgtacaggctttaagtgaattcaaa
gcaatggattccttctag

KEGG   Loxodonta africana (African savanna elephant): 100667386
Entry
100667386         CDS       T04351                                 

Gene name
CTNNA3
Definition
(RefSeq) catenin alpha-3
  KO
K05691  catenin alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04390  Hippo signaling pathway
lav04520  Adherens junction
lav04670  Leukocyte transendothelial migration
lav05100  Bacterial invasion of epithelial cells
lav05200  Pathways in cancer
lav05213  Endometrial cancer
lav05226  Gastric cancer
lav05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100667386 (CTNNA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100667386 (CTNNA3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100667386 (CTNNA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100667386 (CTNNA3)
  09162 Cancer: specific types
   05226 Gastric cancer
    100667386 (CTNNA3)
   05213 Endometrial cancer
    100667386 (CTNNA3)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100667386 (CTNNA3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100667386 (CTNNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100667386 (CTNNA3)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100667386 (CTNNA3)
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 100667386
NCBI-ProteinID: XP_003409083
LinkDB
Position
Unknown
AA seq 895 aa
MSTETPITLNIDPQDLQVQTFTVEKLLEPLIIQVTTLVNCPQNPSSRKKGRSKRARVLLA
SVEEATWNLLEKGEKITQEATVLKEELTAALEEVRKESEALKVSAERFTDDPCYLPKREA
VVQAARALLAAVTRLLILADMIDVTCLLQHVSAFQRTFESLKNVSNKSDLQKTYQKLGKE
LENLDYLAFKRQQDLKSPNQRDEIAGARASLKENSPLLHSICSAYLEHSDVASLKASKDT
VCDEIQTALDVISNASQGIQNMPTPTEPQAATLGSALEELETLIVLDPLTVTEEEIRPSL
EKRLEAIISGAALLADSSCTRDFHRERIIAECNAIRQALQDLLSEYMNNAGKKERSNTLN
IAIDNMCKKTRDLRRQLRKAIIDHVSDSFLDTTVPLLVLIEAAKNGREKEIKEYAAIFRE
HTSRLVEVANLACSMSTNEDGIKIAKIAANHLETLCPQVINAALALAARPKSQVVKNTME
MYKRTWENHIHVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDADNLDRAAGAI
RGRAARVANIVTGEMDSYEPGAYTEGVMRNVNFLTSTVIPEFVTQVNVALEALSKSSMDV
FDDNQFVDISKKIYDTIRDIRCSVMMIRTPEELEDVSDLEEDYEVRSHASVQTEGKTDRA
KMTQLPEGEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKKMCMIMMEMTDFTR
GKGPLKHTTDVIYAAKMISESGSRMDVLARQIADQCPDPSCKQDLLAYLEQIKFYSHQLK
ICSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPAG
PRHPVVMWRMKAPAKKPLIKREKPEETCAAVRRGSAKKKIHPVQVMSEFRGRQFY
NT seq 2688 nt   +upstreamnt  +downstreamnt
atgtccactgagacaccaatcacactgaatattgatcctcaggatctgcaggtccaaaca
ttcactgtcgagaagctactggaacctcttatcatccaggtcaccacacttgtaaattgt
ccccagaatccttccagcaggaaaaaaggacgttcaaagagagccagagttcttctagct
tctgtggaggaagcaacctggaatttattagagaagggagagaagatcacccaggaagcc
acagttttaaaggaagagcttactgctgcacttgaagaagttcgcaaagaaagtgaagct
ctgaaagtatcagctgaaagatttacagatgacccctgttatctcccgaaaagggaggct
gtggttcaagctgcccgcgccttgttggctgcagttactagactccttatcctcgcagac
atgattgatgtcacgtgtctcttgcagcacgtgtcagcttttcaaaggacatttgagtct
cttaaaaatgtttccaacaaatctgacctccagaagacctaccagaaacttgggaaggaa
ctggaaaatctcgattatttagccttcaaacgtcagcaggacttaaaatctccaaaccag
agggatgaaatcgcaggggcccgggcctcactgaaggagaactcccctctcttgcattca
atttgttcagcttatttggagcattctgatgttgcttccctcaaagccagcaaggacaca
gtttgtgacgaaattcagactgccctcgatgtgatttcaaatgcttcacaaggcatccag
aatatgcccaccccaacagaacctcaggcagcaaccctgggaagtgccctggaggagctt
gagactttaattgtcttggatccactcacagtgacagaggaggaaatacgaccatcacta
gagaaacgcctagaagccattatcagtggggcagctctgttggcggactcttcatgcaca
agggatttccatcgggagcgaatcattgcagaatgcaacgcgattcgccaggctcttcag
gacctgctttcagaatatatgaataatgctggaaaaaaggaaaggagtaataccctgaat
atcgccatagacaacatgtgcaagaagacaagagaccttcgcagacagctccgtaaggct
attatagaccatgtgtctgactctttcttggatacgacagtcccacttttggttctcatt
gaagccgctaagaatggccgagagaaggaaataaaagaatatgctgcgatatttcgcgaa
cacaccagcaggcttgtagaggtggcaaatcttgcttgttccatgtcaacaaatgaagat
ggaattaaaattgccaaaattgcagccaatcacctagaaaccttgtgtccacaggttatt
aatgctgcacttgctttggctgcaagacccaagagccaagtggtcaaaaacacgatggaa
atgtacaagcgcacatgggagaatcacatacacgtcctcaccgaagctgtagatgatatt
acgagcattgatgacttccttgctgtatctgagagccatatcctggaagatgtcaacaag
tgcatcatagccttgagggaccaggatgctgataatttggaccgtgctgctggtgctatc
agaggacgggcagctagagtggctaatattgtcacaggtgaaatggacagttacgagcca
ggtgcttacactgaaggtgtgatgagaaatgttaacttccttacaagtactgtaattcct
gagtttgtaacacaagtgaacgtcgccttggaagccttaagcaagagctcaatggatgtg
tttgacgacaaccaatttgtggacatctcaaagaagatctatgatacaattcgtgatatc
agatgttcggtcatgatgattcggaccccagaggagctggaggatgtttctgacctggaa
gaggactatgaggtccgcagtcatgccagcgttcagacagaagggaaaactgaccgggct
aagatgactcaactgcctgagggggaaaaggaaaagattgctgagcaagttgctgatttc
aagaaagtcaagagtaagctggatgccgagattgagatatgggatgacacgagcaatgat
atcattgtgttggccaagaagatgtgcatgatcatgatggagatgacagacttcacaagg
ggaaaagggccactaaagcatacaactgatgtgatctacgcagctaaaatgatatcagaa
tcaggatcgaggatggatgtccttgcacgtcagattgctgaccagtgtccagatccatca
tgcaaacaggacttgttggcctacctggaacagatcaagttctactctcaccaactgaaa
atctgcagtcaagttaaagctgagatccagaacctagggggagagcttatcatgtcagct
ttggacagtgtcacctccctgattcaagcagccaaaaatttaatgaatgctgtagtgcaa
acagtgaaaatgtcttacattgcctcaaccaagatcattcgaattcagagtcctgctggg
ccccggcacccagttgtgatgtggaggatgaaggctcctgcaaaaaagcccttgattaaa
agagagaagccagaggaaacctgtgcagcggtcagaagaggctcagccaagaaaaaaatc
catccggttcaagtcatgagtgaatttagaggaagacagttctactga

KEGG   Loxodonta africana (African savanna elephant): 100672682
Entry
100672682         CDS       T04351                                 

Gene name
CTNNA1
Definition
(RefSeq) LOW QUALITY PROTEIN: catenin alpha-1
  KO
K05691  catenin alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04390  Hippo signaling pathway
lav04520  Adherens junction
lav04670  Leukocyte transendothelial migration
lav05100  Bacterial invasion of epithelial cells
lav05200  Pathways in cancer
lav05213  Endometrial cancer
lav05226  Gastric cancer
lav05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100672682 (CTNNA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100672682 (CTNNA1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100672682 (CTNNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100672682 (CTNNA1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100672682 (CTNNA1)
   05213 Endometrial cancer
    100672682 (CTNNA1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100672682 (CTNNA1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100672682 (CTNNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100672682 (CTNNA1)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100672682 (CTNNA1)
SSDB
Motif
Pfam: Vinculin Peptidase_C5
Other DBs
NCBI-GeneID: 100672682
NCBI-ProteinID: XP_003404574
LinkDB
Position
Unknown
AA seq 906 aa
MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHV
LAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQGDLMKSAAGEFADDPCSSVK
RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGTEQDLGIQYKAL
KPEVDKLNIMASKRQRELKDAGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKAN
RDLIYKQLQQAVTGISNAAQATASDDASQHQGGGGGELAYALNNFDKQIIVDPLSFSEER
FRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMGNAGRKER
SDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYA
QVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLA
QENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDR
TAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSS
DPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTED
DQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMC
MIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYL
QXIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVAS
TKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEF
KAMDSI
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgactgctgtccatgcaggcaacataaacttcaaatgggaccccaaaagtctagagatc
aggactctggcagttgaaagactgttggaacctcttgttacacaggttacaaccctggta
aacacgaatagtaagggcccctctaataagaagagaggtcgttctaagaaagcccatgtt
ttggctgcatctgttgaacaagcaactgagaatttcctggagaagggtgataaaattgca
aaggagagtcagtttctcaaggaggagcttgtggctgctgtagaagatgttcgtaaacaa
ggtgacttgatgaagagtgctgcgggagagtttgcggatgatccctgctcttctgtgaaa
cgtggcaacatggttcgcgcggctcgagcgttgctctctgccgttacccggctgctgatt
ttggctgacatggcagatgtctacaaattacttgttcagctgaaagtcgtagaagatggt
atcttgaaactgaggaacgctggcaccgaacaagacttaggaatacagtataaagccctg
aaacctgaagtggataagctgaacattatggcatccaaaagacaacgggaactgaaagat
gcgggccatcgtgatcagatggctgcagccagaggaatcctgcagaaaaatgttccgatc
ctctatactgcatcccaggcatgcctacagcaccctgatgtcgcagcctataaggccaac
agggacctgatatacaagcagctgcagcaggcggtcacgggcatttccaacgctgcccag
gccaccgcgtcagacgatgcctcccagcaccagggtggtggtggaggagaactggcttac
gcgctcaataactttgataaacaaatcatcgtggaccccttgagcttcagcgaggagcgc
tttaggccttcccttgaggaacgcctggaaagcatcattagtggagctgccctaatggca
gactcatcctgcacacgtgatgaccggcgtgaacgaattgtggcagagtgcaacgcagtc
cgccaggccctgcaggacctgctgtctgagtacatgggcaacgctggacgtaaagaaaga
agcgatgcactcaattctgcaatagataaaatgaccaagaagaccagggacttacgtcga
cagctccgcaaagctgtcatggaccacgtttcagattctttcctggaaaccaacgttcca
cttttagtattgatcgaagctgcaaagaatggaaatgaaaaagaagttaaggagtatgcc
caggttttccgtgaacatgccaacaaattgattgaggttgccaacctggcctgttctatc
tcaaacaatgaagaaggtgtgaagcttgtccgaatgtctgcaagccaattagaagccctc
tgtcctcaggttatcaatgctgcactggcattagcggcaaaaccacagagtaaactggcc
caagagaacatggatctttttaaagaacaatgggaaaaacaagtccgtgtcctcaccgat
gctgtagatgacattacttccattgatgacttcttggctgtctcagagaatcacattttg
gaagatgtgaacaaatgcgtcattgctctgcaagaaaaagatgtggatgggttagaccgc
acagctggagcaattcgaggccgggcagcccgggtcattcatgtggtcacctcagagatg
gacaactacgagccaggggtctacacggagaaggttctggaggccaccaagctgctttcc
aacacagtcatgccacgtttcaccgagcaagtggaagcggcggtggaagccctcagctca
gaccccgcccagcccatggacgagaatgagtttatcgatgcctcccgcctggtgtacgat
ggcatccgggacatcaggaaagcagtgttgatgataaggacccctgaggagttggatgac
tctgactttgagacggaagattttgacgtcagaagtagaacaagcgtccaaacagaagac
gatcagctgatcgccggccaaagtgcccgggcgatcatggctcagcttccccaggagcag
aaagcaaagattgcagagcaggtggccagcttccaggaagaaaagagcaagctggatgct
gaagtgtccaaatgggacgacagtggcaacgacatcatcgtactggccaagcagatgtgc
atgattatgatggagatgaccgacttcacccgcggtaaaggaccactcaaaaatacctca
gatgtgatcagtgccgccaagaaaattgctgaggcaggttccaggatggataagcttggc
cgtaccattgcagaccattgcccagactccgcctgcaagcaggacctgctggcctacctg
cagncgatcgccctctactgccaccagctcaacatctgcagcaaagtcaaggccgaggtg
cagaacctcggcggggagcttgttgtctcaggggtggacagcgccatgtcgctgatccag
gcggccaagaacctgatgaatgctgtggtgcagacagtgaaggcgtcctacgtagcctcc
accaaataccagaagtctcagggcatggcctccctcaacctccctgccgtgtcgtggaag
atgaaggcacctgagaaaaagcccttggtgaagagagagaaacaggatgagacgcagacc
aagatcaaacgggcatctcagaagaagcatgtgaaccctgtgcaggcccttagtgagttc
aaagctatggacagcatctaa

DBGET integrated database retrieval system