KEGG   Loxodonta africana (African savanna elephant): 100661838
Entry
100661838         CDS       T04351                                 

Gene name
AREG
Definition
(RefSeq) amphiregulin
  KO
K09782  amphiregulin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04390  Hippo signaling pathway
lav05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100661838 (AREG)
   04012 ErbB signaling pathway
    100661838 (AREG)
   04390 Hippo signaling pathway
    100661838 (AREG)
   04151 PI3K-Akt signaling pathway
    100661838 (AREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    100661838 (AREG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:lav03110]
    100661838 (AREG)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100661838 (AREG)
Chaperones and folding catalysts [BR:lav03110]
 Intramolecular chaperones
  Others
   100661838 (AREG)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100661838 (AREG)
SSDB
Motif
Pfam: Pestivirus_E2 EGF FtsL Rieske
Other DBs
NCBI-GeneID: 100661838
NCBI-ProteinID: XP_003414265
UniProt: G3TC91
LinkDB
Position
Unknown
AA seq 249 aa
MRTSLRLLPAPVALLLLVILGSGHYVAGSEHKGTYSGKGEQFSEDHSASGLEVMVTSRSE
MSSVSAMPSGGELSSETDYDYSEEYDDEPQISGYIVDDSVKVEQVVKPPHNKTESEQTSS
KPKRKKKAGKNGKNRKNKKKTPCDAEFQNFCIHGECKYIEHLKAISCKCHQDYFGERCGE
KTMKTQRMVDNDLSKIALAAIVAFVSAVSLTAVVVVITNQLRKRYFREYEGESEETKKLR
QENNAHTIV
NT seq 750 nt   +upstreamnt  +downstreamnt
atgagaacctcgctgcggctgctgccggcgccggtggcgctcttgctattagtgatcctc
ggctcagggcattatgttgctggatcagaacacaaaggcacctactctgggaaaggggaa
caattttctgaggaccacagtgccagtgggcttgaggtgatggtgacttcaagaagtgag
atgtcctcagtgagtgcaatgccttctggtggcgaactgtcctcagagactgactatgac
tattcagaagagtatgacgatgaaccacaaatatccggctatatagtagatgattcagtc
aaagttgaacaggtagttaaacccccccataacaaaacagaaagtgaacagacttcaagc
aaacctaaaagaaagaaaaaggctggcaaaaacggaaaaaatcgaaaaaacaaaaagaaa
actccatgtgatgcagaattccaaaatttctgcattcatggagaatgcaaatacatagag
cacctgaaagcaatatcatgcaagtgtcatcaggattactttggtgagcgatgtggggaa
aagactatgaagactcaaagaatggttgacaatgacttatcaaaaatcgctttagcagcc
atagttgcctttgtctctgccgtgagcctcacagctgttgttgtggtcattacaaaccag
cttcgaaaacgatacttcagagaatatgaaggagaatcagaagaaacaaagaaacttcga
caagaaaataatgcacataccattgtataa

DBGET integrated database retrieval system