KEGG   Loxodonta africana (African savanna elephant): 100662022
Entry
100662022         CDS       T04351                                 

Gene name
GNRHR
Definition
(RefSeq) gonadotropin-releasing hormone receptor isoform X1
  KO
K04280  gonadotropin-releasing hormone receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100662022 (GNRHR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100662022 (GNRHR)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Peptide
   Gonadotropin-releasing hormone (GnRH)
    100662022 (GNRHR)
SSDB
Motif
Pfam: 7tm_1 Spo7 PTS_EIIC_2
Other DBs
NCBI-GeneID: 100662022
NCBI-ProteinID: XP_003415950
UniProt: G3SWM6
LinkDB
Position
Unknown
AA seq 328 aa
MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSTTFNAAFLLKL
QKRSQKKEKGKKPSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYL
KLFSMYSPAFMMVVISLDRSLAITRPIAVKSYSKLRQSMIGLAWILSSVFAGPQLYIFRM
IHVADSSGQIDVFSQCVTHCSFPQWWQQAFYNLFTFSCLFLIPLLITLICNAKIIFTLTR
VLRQDPHKLQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRV
SDPVNHFFFLFAFLNPCFDPLIYGYFSL
NT seq 987 nt   +upstreamnt  +downstreamnt
atggcaaacagtgcctctcctgaacagaatcaaaatcactgctcagccatcaacaacagc
atcccactgatgcagggaaacctccccacactgacgttatccggaaagatccgagtgaca
gttactttcttcctttttctactttccacaacctttaacgctgctttcctgttgaaactt
cagaagcggagtcaaaagaaggagaaagggaaaaagccctcaagaatgaagttgctttta
aaacatctgaccttagccaacctgctggagactctgattgtcatgccactggatggaatg
tggaatattacagtccaatggtacgctggagagttcctctgcaaagtcctcagctatctg
aagcttttctccatgtactccccagcctttatgatggtagtgatcagcctggatcgctcc
ctggccattacgaggcccatagctgtgaaaagctacagtaagctcagacagtccatgatt
ggcctggcctggatcctcagtagtgtctttgctggaccacagttatatatcttcaggatg
atccatgtagcagacagctctggacagattgacgttttctctcaatgtgtaacacactgc
agttttccacagtggtggcagcaagccttttataaccttttcaccttcagctgcctcttc
ctcatccctcttctcatcacgttgatctgcaatgcaaaaatcatcttcaccctgacacgg
gtacttcgtcaggatccccacaaactacaactgaatcaatccaagaacaatataccaaga
gcacggctgaagaccttaaagatgacagttgcgtttgccacttcatttactgtctgctgg
actccctactatgtcctaggaatttggtactggtttgaccctgaaatgttaaacagggtg
tctgacccagtaaatcacttcttctttctctttgcttttttaaatccatgctttgatcca
cttatatatggatatttctctctgtaa

KEGG   Loxodonta africana (African savanna elephant): 100668594
Entry
100668594         CDS       T04351                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: gonadotropin-releasing hormone II receptor
  KO
K04280  gonadotropin-releasing hormone receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100668594
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100668594
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Peptide
   Gonadotropin-releasing hormone (GnRH)
    100668594
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 100668594
NCBI-ProteinID: XP_003422010
LinkDB
Position
Unknown
AA seq 380 aa
MSTGNGTPWGSAAGEEAWAGSGVEVEGSELPTFSAAAKVRVGVTIVLFVSSAGGNLAVLW
SVTRPQPSQARPSPVRRLFAHLAAADLLVTFVVMPLDATWNITVQWLAGDIACRTLMFLK
LMAMYAAAFLPVVIGLDRQAAVLHPFGPRSGGRKLLGAAWGFSFLLALPQLFLFHTVRRA
GPVSFTQCVTKGSFKARWQETTYNFFTFCCLFLLPLTAMAICYSRIVLSVSSPRKRKGNH
ASADEFALRRSLDNRPRVRLRALLLALLVLLTFILCWTPYYLLGLWYWFSPTMLTEVPSS
LSHILFLFGLLNAPLDPLLYGAFTLGCRRGHQEPGAASSREEGSGRMPLRQLEAHTNVGA
SRAGETKDIPITSICLGQSI
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgtctacaggcaacggcaccccttgggggtcagcagcaggggaggaggcctgggcggga
tccggagtggaggttgagggatcagagctgcccaccttctcagccgcagccaaggtccga
gtaggagtgaccattgtgctgtttgtttcttcagctggagggaacctggccgtattgtgg
tcagtgacacggccgcaacccagccaggcccgcccctcgccggtccggcgactttttgcc
catttagcagctgcagatttactggtcacttttgtggttatgcccctagatgccacctgg
aatatcactgttcagtggctggccggggacatcgcctgtcggacactcatgttcctgaaa
ctaatggccatgtacgccgcagctttcctgcctgtggtcattgggcttgaccgtcaggca
gcagtactccacccgtttggaccccgctcaggtggaaggaagcttctgggggcagcttgg
ggttttagtttcctgcttgccttgccccagctgttcctgttccatactgtccgccgagct
ggcccagtctcttttacacagtgtgtcaccaaaggcagcttcaaggctcgctggcaagag
accacctataacttcttcaccttctgctgcctctttctgctgccattgactgccatggcc
atctgctatagccgcattgtcctcagtgtgtccagtccccggaaaaggaaagggaaccat
gcctctgctgatgaatttgcactccgccgctccttagacaatcgccctcgtgtccgcctg
cgggccctgctactggccctccttgtcttgctgaccttcatcctctgctggacaccttat
tacctgctgggtctgtggtactggttctcccccaccatgctaactgaagtcccctccagc
ctcagccacatccttttcctctttggcctcctcaacgctcctctggatcctctactctat
ggggccttcacacttggctgccgaagagggcaccaagaaccaggcgcagcgtcctccagg
gaagaagggtctggcagaatgcccctgagacagctagaagcacacacaaatgtaggagca
agtagggcaggagaaaccaaagacattcctataacatccatttgcttaggacagagtata
tag

DBGET integrated database retrieval system