KEGG   Loxodonta africana (African savanna elephant): 100662045
Entry
100662045         CDS       T04351                                 

Gene name
EZR
Definition
(RefSeq) ezrin isoform X1
  KO
K08007  villin 2 (ezrin)
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04530  Tight junction
lav04670  Leukocyte transendothelial migration
lav04810  Regulation of actin cytoskeleton
lav04971  Gastric acid secretion
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100662045 (EZR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100662045 (EZR)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100662045 (EZR)
  09154 Digestive system
   04971 Gastric acid secretion
    100662045 (EZR)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100662045 (EZR)
   05205 Proteoglycans in cancer
    100662045 (EZR)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Gelsolin / villin
     100662045 (EZR)
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100662045 (EZR)
SSDB
Motif
Pfam: ERM FERM_C FERM_M FERM_N
Other DBs
NCBI-GeneID: 100662045
NCBI-ProteinID: XP_010597143
LinkDB
Position
Unknown
AA seq 586 aa
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYVDNKGFPTWLK
LDKKVSAQELRKETPLQFRFRAKFYPEDVPEELIQDITQKLFFLQVKEGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKELHKSGYLSSERLVPQRVMDQHKLTRDQWEDRIQVWHAEHR
GMLRDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKQQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEQKTKK
AEKELSDQIQRALQLEEERKRAQEEAERLEADRVAALRAKEELERQAVDQIKSQEQLAAE
LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP
VNYHVQDNLQEEGPEYTGYSAELSSEGIMGDRNEEKRITEAEKNERVQRQLLTLTNELSQ
ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAM
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgccgaaaccaatcaatgtccgggtcaccacaatggatgcagagctggagtttgccatc
cagccaaatactactgggaagcagctttttgatcaggtggttaagactattggacttcgg
gaagtatggtactttggcctccagtacgtggataataaaggatttccaacctggttgaaa
cttgataagaaggtgtctgcccaggagctcagaaaggagacccccctccagttcaggttc
cgcgccaagttctacccggaagacgtgcctgaggagctcatccaggacatcacccagaag
ctcttcttcctgcaagtgaaggaggggatcctcagcgatgagatctactgtccccctgag
accgcggtgctcctgggctcctacgcagtgcaggccaagtttggagattacaacaaagag
ttgcacaagtctgggtacctcagctccgagcggctggtcccccaaagagtgatggaccag
cacaagctgactcgggaccagtgggaggaccgtatccaggtgtggcatgctgaacaccgt
gggatgctcagagacagcgcgatgctggagtatctgaagattgctcaggacctggagatg
tatggaatcaactattttgagataaaaaataagaaaggaacagacctgtggcttggagtt
gacgcccttgggctgaacatttatgagaaagatgataagttgaccccaaagattggcttc
ccttggagtgaaatcagaaacatctccttcaacgacaagaagtttgtcattaagcccatc
gacaagaaggcacctgacttcgtattctacgccccgcgtctgcggatcaacaagcggatc
ctgcagctctgcatggggaaccacgagctgtacatgcgccgtcgcaagcccgacaccatc
gaggtgcagcagatgaaggcccaggcccgcgaggagaagcagcagaagcaactggagcgg
caacagctggaaactgagaagaagaggagagaaacagtcgagagggagaaagagcagatg
atgcgggagaaggaggaactgatgctgaggctgcaggactacgagcagaaaaccaagaag
gccgagaaagaactttctgaccagatccagagagccctgcagctggaggaggagaggaag
cgcgcccaggaggaggcggagcgcttggaggctgaccgtgtggctgcgctgcgggccaag
gaggagctggagagacaggctgtggatcagataaagagccaggagcagctggccgcggag
ctggccgagtacacggccaagattgccctgctggaggaggcacggcggcgcaaggaagac
gaggtggaggaatggcagcaccgggccaaagaggcccaggatgacctggtgaagaccaag
gaggagctgcacctggtgatgacggcgcccccaccgcccccgccccccgtgtacgagcca
gtgaattaccacgtccaggacaacctgcaggaggagggccctgagtacacgggctacagc
gccgagctctccagtgagggtatcatgggcgaccgcaacgaggagaagcggatcaccgag
gccgagaagaacgagcgcgtgcagcggcagctgctgactttgaccaatgagttgtcccag
gccagagatgagaataagaggacccacaacgacatcatccacaatgagaacatgcggcaa
ggccgtgacaagtacaagacactgcggcagatccggcagggcaacaccaagcagaggatt
gatgagttcgaggccatgtag

DBGET integrated database retrieval system