KEGG   Loxodonta africana (African savanna elephant): 100662121
Entry
100662121         CDS       T04351                                 

Gene name
EREG
Definition
(RefSeq) proepiregulin
  KO
K09784  epiregulin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04151  PI3K-Akt signaling pathway
lav05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100662121 (EREG)
   04012 ErbB signaling pathway
    100662121 (EREG)
   04151 PI3K-Akt signaling pathway
    100662121 (EREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    100662121 (EREG)
SSDB
Motif
Pfam: EGF BCCT
Other DBs
NCBI-GeneID: 100662121
NCBI-ProteinID: XP_010592437
LinkDB
Position
Unknown
AA seq 163 aa
MEMRGAGRVPALLLCLGFHLLQAVLSTTVIPSCIPGESDDNCTALVQTEDNPRVAQVSIT
KCGSDMNGYCLHGHCIFLVNMNEHYCRCDVGYTGVRCEHFFLTVHQPLSKEYVALTVILT
IFFLVTVAGSLYYFCRWYRNRKSKEPKKEYERVTSGDPTLPQV
NT seq 492 nt   +upstreamnt  +downstreamnt
atggagatgcgcggtgcaggtcgtgtcccggcgctgctgctctgcctcggtttccatctt
ctccaagcagttctaagcacaactgtgatcccatcatgcatcccaggagagtctgacgat
aactgcacagctttagttcagacagaagacaatccccgggttgctcaggtatcaataaca
aagtgtggctccgacatgaatggctactgtttgcatggacactgcatcttcctggtgaac
atgaatgagcattactgcaggtgtgatgtgggatacactggtgtccgatgcgaacacttc
tttttaaccgtccaccaacccttgagcaaagaatatgtggctttgactgtgattcttact
attttttttcttgtcacggttgcaggttccctatactacttctgcagatggtacagaaat
agaaaaagtaaagaaccaaagaaagaatatgaaagggtgacctctggggatccaacattg
ccacaagtctga

DBGET integrated database retrieval system