KEGG   Loxodonta africana (African savanna elephant): 100662196
Entry
100662196         CDS       T04351                                 

Gene name
BID
Definition
(RefSeq) BH3-interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01524  Platinum drug resistance
lav04071  Sphingolipid signaling pathway
lav04115  p53 signaling pathway
lav04210  Apoptosis
lav04215  Apoptosis - multiple species
lav04217  Necroptosis
lav04650  Natural killer cell mediated cytotoxicity
lav04932  Non-alcoholic fatty liver disease
lav05010  Alzheimer disease
lav05014  Amyotrophic lateral sclerosis
lav05022  Pathways of neurodegeneration - multiple diseases
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100662196 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100662196 (BID)
   04215 Apoptosis - multiple species
    100662196 (BID)
   04217 Necroptosis
    100662196 (BID)
   04115 p53 signaling pathway
    100662196 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100662196 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100662196 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100662196 (BID)
   05014 Amyotrophic lateral sclerosis
    100662196 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    100662196 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100662196 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100662196 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100662196 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100662196 (BID)
   05161 Hepatitis B
    100662196 (BID)
   05160 Hepatitis C
    100662196 (BID)
   05164 Influenza A
    100662196 (BID)
   05162 Measles
    100662196 (BID)
   05168 Herpes simplex virus 1 infection
    100662196 (BID)
   05163 Human cytomegalovirus infection
    100662196 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100662196 (BID)
   05169 Epstein-Barr virus infection
    100662196 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100662196 (BID)
SSDB
Motif
Pfam: BID Bcl-2 Rab_bind
Other DBs
NCBI-GeneID: 100662196
NCBI-ProteinID: XP_010589079
LinkDB
Position
Unknown
AA seq 199 aa
MALTVSNGSGLQNERITNLLVFSFLKNCPSCHFHEELAELSYELPLPAHLREEYDELQTD
GNRNSHFHFQSFQGRLEQDSGSQEEVIQSIAERLAQIGDEMESQVHPSLVQNLARQFMDR
NLSEEDRRKHLATAVDRVMQTCLLDMELEKKKLMLTMLLAKKVADHMPSLLRDVFRTTVN
FINQNLLTYVRNLARNEMD
NT seq 600 nt   +upstreamnt  +downstreamnt
atggcgcttacggtcagcaatggttcaggcctccagaacgagcgcatcacaaacctgctg
gtgttcagctttctcaaaaactgccccagctgtcatttccacgaagagctggcggagttg
agctacgagcttcccctgccagctcacctgcgggaggagtatgatgaactgcagacagac
ggcaaccggaacagccacttccacttccaaagttttcagggaagacttgagcaagattct
ggaagtcaagaggaagtcatccagagcatcgctgagcgtcttgcccaaataggagacgag
atggaaagccaggtccacccaagtctggtgcaaaacctggcaaggcagtttatggacagg
aacctgtcagaagaagacagaaggaagcacctggcaactgccgtggaccgggtgatgcag
acctgtctcctggacatggagttggaaaagaaaaagctcatgttgaccatgctgttggcc
aaaaaagtagccgatcacatgccttccttgctccgtgatgtctttcgcacaactgtgaat
tttattaaccagaacctactcacctatgtgaggaacttagccagaaatgagatggactga

DBGET integrated database retrieval system