KEGG   Loxodonta africana (African savanna elephant): 100662222
Entry
100662222         CDS       T04351                                 

Gene name
PRKCI
Definition
(RefSeq) protein kinase C iota type isoform X1
  KO
K06069  atypical protein kinase C iota type [EC:2.7.11.13]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04144  Endocytosis
lav04390  Hippo signaling pathway
lav04530  Tight junction
lav04611  Platelet activation
lav04910  Insulin signaling pathway
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100662222 (PRKCI)
   04390 Hippo signaling pathway
    100662222 (PRKCI)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100662222 (PRKCI)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100662222 (PRKCI)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100662222 (PRKCI)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100662222 (PRKCI)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100662222 (PRKCI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100662222 (PRKCI)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100662222 (PRKCI)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100662222 (PRKCI)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 PB1 Pkinase_C Kinase-like APH C1_2 Kdo
Other DBs
NCBI-GeneID: 100662222
NCBI-ProteinID: XP_003416291
LinkDB
Position
Unknown
AA seq 560 aa
MITHFEPSISFEGLCSEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELN
KDSELLIHVFPCVPERPGMPCPGEDKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAI
CTDRIWGLGRQGYKCINCKLLVHKKCHKLVTVECGRHSLPPEPMMPMDQSSMHSDHAQTV
IPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKT
DRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVN
GGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTD
YGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIV
GSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADI
QGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLTPDDDDIVKKIDQ
SEFEGFEYINPLLMSAEECV
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgataacacattttgaaccttcaatctcctttgagggcctttgcagtgaggttcgagat
atgtgttcttttgacaatgaacagcttttcaccatgaaatggatagacgaggaaggagac
ccgtgtacagtatcatctcagttggagttagaagaagcctttaggctttatgagctaaac
aaggattctgaactcttaattcacgtattcccctgtgtaccagaacgccctggaatgccc
tgtccaggagaagataaatctatctatcgccgaggtgcacgccgctggagaaagctttat
tgtgcaaatggccatactttccaagccaagcgtttcaacaggcgtgcccactgtgccatc
tgcactgaccgaatatggggacttggacgccagggatataagtgcatcaactgcaaacta
ctagttcataagaagtgccacaaactcgtcacagttgaatgtgggcgacattctttgcca
ccggaaccaatgatgcccatggatcagtcatccatgcattcggaccatgcacagacagta
attccatataatccttcaagtcatgagagcttggaccaagttggtgaagaaaaggaggca
atgaacaccagagaaagtggcaaagcttcatccagtttaggacttcaggattttgatttg
ctccgggttataggaagaggaagttatgccaaagtactactggttcgattaaaaaaaaca
gatcgtatttatgcaatgaaagttgtgaaaaaggagcttgtcaatgatgatgaggatatt
gattgggtgcagacagagaagcatgtttttgagcaggcatccaatcatccttttcttgtt
gggctgcattcttgctttcagaccgaaagcaggttgttctttgttatagagtatgtaaat
ggaggagatctaatgtttcatatgcagagacaaagaaaacttcccgaagaacatgccaga
ttttactctgcagaaatcagtctagcattaaattatcttcatgagcgagggataatatat
agagatttgaaattggacaatgtattactggactctgaaggacacattaaactcactgac
tatgggatgtgtaaggaaggattacggccaggagatacaactagcactttctgtggtact
cctaattacattgctccggaaattctaagaggagaagattatggttttagtgtcgactgg
tgggctcttggagtgctaatgtttgagatgatggcaggaaggtctccatttgatatcgtt
gggagctctgataaccctgatcaaaacaccgaggattatctcttccaagttattttggaa
aaacaaattcgaataccacgttctctgtctgtaaaagctgcaagtgtcctgaagagtttt
ctcaacaaggatccaaaagaacgattgggttgtcatcctcaaacgggatttgctgatatt
cagggacacccattcttccgaaatgtggattgggatatgatggagcaaaagcaagtggta
cctccctttaaaccaaatatttctggggaatttggtttggacaactttgattctcagttt
actaatgaacctgtccagctcactccagatgatgatgacattgtgaagaagattgaccag
tctgaatttgaaggtttcgagtatatcaatcctcttctgatgtctgcagaagaatgtgtc
tga

KEGG   Loxodonta africana (African savanna elephant): 100673102
Entry
100673102         CDS       T04351                                 

Gene name
PRKCZ
Definition
(RefSeq) protein kinase C zeta type isoform X1
  KO
K18952  atypical protein kinase C zeta type [EC:2.7.11.13]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04062  Chemokine signaling pathway
lav04071  Sphingolipid signaling pathway
lav04144  Endocytosis
lav04360  Axon guidance
lav04390  Hippo signaling pathway
lav04530  Tight junction
lav04611  Platelet activation
lav04910  Insulin signaling pathway
lav04926  Relaxin signaling pathway
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05165  Human papillomavirus infection
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100673102 (PRKCZ)
   04390 Hippo signaling pathway
    100673102 (PRKCZ)
   04071 Sphingolipid signaling pathway
    100673102 (PRKCZ)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100673102 (PRKCZ)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100673102 (PRKCZ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100673102 (PRKCZ)
   04062 Chemokine signaling pathway
    100673102 (PRKCZ)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100673102 (PRKCZ)
   04926 Relaxin signaling pathway
    100673102 (PRKCZ)
  09158 Development and regeneration
   04360 Axon guidance
    100673102 (PRKCZ)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100673102 (PRKCZ)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100673102 (PRKCZ)
   04931 Insulin resistance
    100673102 (PRKCZ)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100673102 (PRKCZ)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100673102 (PRKCZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100673102 (PRKCZ)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100673102 (PRKCZ)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100673102 (PRKCZ)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 C1_1 Pkinase_C Kinase-like APH C1_2 Kdo GDI
Other DBs
NCBI-GeneID: 100673102
NCBI-ProteinID: XP_023407912
LinkDB
Position
Unknown
AA seq 592 aa
MPSRTGANMDGSGCRVRLKAHYSGDILITSLDAATTFEELCEDVREMCRLHQGQPLTLKW
VDDEGDPCTVSSQMELEEAFRLSCQRRDEGLIIHVFPSIPEEPGMPCPGEDKSIYRRGAR
RWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLGRQGYKCINCKLLVHKRCHILVPLTC
EKHMDSVMPSQEPPVDDKNDDVDLPSEETDGIAYISSTRKHDNIKDDSEDLKPVIDGMDG
IKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTE
KHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEI
CIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAP
EILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRF
LSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQIT
DDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSTEESV
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgccgagccggaccggcgccaacatggacgggagcggctgccgtgtccgcctgaaggcg
cactatagcggggacattctgatcaccagcctggatgcagctaccaccttcgaagagctc
tgtgaggacgtacgggagatgtgccgcctgcaccagggccagccgctcaccctcaagtgg
gtcgacgatgaaggtgacccctgcactgtgtcctcccagatggagctggaggaggccttc
cgcctgtcctgtcagcgcagggacgaagggctcatcattcatgtgttcccgagcatccct
gaggagcccggcatgccctgcccaggagaagacaagtccatctaccgccgcggagccaga
agatggaggaagctctaccgcgccaacggccatctcttccaagccaagcgctttaacagg
agagcatactgcggccagtgcagcgaaaggatatggggtctcggaaggcaaggctacaag
tgtatcaactgcaaactcttggtccataaacgctgccacatccttgtcccgctgacctgt
gaaaagcatatggattctgtcatgccttcccaggaacctccagtagatgacaagaacgac
gacgtagacctgccctccgaggagactgatggaattgcttatatttcttcaacccggaaa
catgacaacattaaagatgattctgaggaccttaaaccggttattgatgggatggatgga
atcaagatatctcaggggcttgggctgcaggacttcgacttaatcagagtcattgggcga
gggagctacgccaaagtcctcttggtgcgattgaaaaagaacgatcagatctacgccatg
aaggtggtgaaaaaggagctggtccatgatgatgaggacatcgactgggtacaaacagag
aagcacgtgtttgagcaggcatccagcaaccccttcttggttggcttacattcctgcttc
caaacaacaagtcggttgttcctggtcatcgagtacgtcaacggcggggacctcatgttc
cacatgcagaggcagcggaagcttccggaggagcatgccaggttctacgccgctgagatc
tgcatcgccctaaacttcctgcacgagagggggatcatctaccgggacctgaagctggac
aacgtgctgctggatgctgacgggcacatcaagctgaccgactacggcatgtgcaaggaa
ggcctgggccccggcgacaccacaagcaccttctgcgggaccccgaattacatcgccccg
gaaatcctgcggggagaggagtatgggttcagcgtggactggtgggcccttggtgtgctg
atgttcgagatgatggctgggcggtccccctttgacatcatcaccgataaccccgacatg
aacacggaggactaccttttccaagtgatcctggagaagcccattcggatcccccgcttc
ctctccgtcaaagcttcccatgtcctcaaaggatttttaaacaaggaccccaaagagagg
ctcggctgccggccccagacgggattctcggacatcaagtctcacgccttcttccgcagc
atcgactgggacctgctggagaagaagcaggccctccctccgttccagccacagatcacg
gatgactatggcctcgacaacttcgacacgcagttcaccagcgagccagtgcagctcacc
ccggacgacgaggacgtcatcaagaggatcgaccagtccgagtttgaaggcttcgagtac
atcaaccccttactgctctccactgaggagtccgtgtga

DBGET integrated database retrieval system