KEGG   Loxodonta africana (African savanna elephant): 100662288
Entry
100662288         CDS       T04351                                 

Gene name
NKX3-1
Definition
(RefSeq) homeobox protein Nkx-3.1
  KO
K09348  homeobox protein Nkx-3.1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav05200  Pathways in cancer
lav05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100662288 (NKX3-1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100662288 (NKX3-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100662288 (NKX3-1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, NK-2
    100662288 (NKX3-1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN Homez
Other DBs
NCBI-GeneID: 100662288
NCBI-ProteinID: XP_010590671
UniProt: G3T2T6
LinkDB
Position
Unknown
AA seq 248 aa
MLRTPKLRPGVAGTADCLPQTTPPPQSRPLTSFLIQDILRDCAERRGGSHTGSPEPQPQP
QPPRELAPHQDPDPEPEGGRGRAGGPEDELSAQPGAAPGEAGNLAETEPDRHFETYLFDC
ENTSGALPDLPPTPKQPQKRSRAAFSHTQVVELERKFSHQKYLSAPERAHLAKNLKLTET
QVKIWFQNRRYKTKRKQLTSDLGDLEKHPSLPALKEEGFNRASLISLYNSYPYYPYLYCL
GSWSPAFW
NT seq 747 nt   +upstreamnt  +downstreamnt
atgctcaggactccgaagctgcggcccggggtcgcggggaccgccgactgccttccccag
accacgccgccgccgcagtccaggccgctcacttccttcctcatccaggatattctgcgg
gactgcgccgagcggcgcggcggcagccacacgggcagcccggagccgcagccccagccg
cagcccccgcgcgagctggccccgcaccaggacccagacccggagcccgagggaggccga
ggccgcgccggaggcccggaggacgagctgagcgcccagcccggcgccgctccgggggag
gccgggaacctggcggagaccgagccagataggcactttgagacttatctgtttgactgt
gaaaacacttcaggcgccttaccagacctcccgccaacacccaagcagccacagaagcgc
tcccgagcagccttctcccacacgcaggtcgttgaattagagaggaagttcagccatcag
aagtacctgtcagcccctgaaagggctcacctggccaagaacctcaagctcactgagacc
caagtcaaaatctggttccagaacagacgctataagaccaagcgaaagcagctcacctcc
gacctgggagacctggagaagcacccctccctgccagccctgaaagaggagggcttcaat
cgggcctccctgatctccttgtataacagctatccatactacccctacctttactgcctg
gggagctggagcccggctttctggtaa

DBGET integrated database retrieval system