KEGG   Loxodonta africana (African savanna elephant): 100662289
Entry
100662289         CDS       T04351                                 

Gene name
FGFR1
Definition
(RefSeq) fibroblast growth factor receptor 1 isoform X3
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04520  Adherens junction
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04714  Thermogenesis
lav04810  Regulation of actin cytoskeleton
lav04928  Parathyroid hormone synthesis, secretion and action
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05215  Prostate cancer
lav05218  Melanoma
lav05224  Breast cancer
lav05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100662289 (FGFR1)
   04014 Ras signaling pathway
    100662289 (FGFR1)
   04015 Rap1 signaling pathway
    100662289 (FGFR1)
   04020 Calcium signaling pathway
    100662289 (FGFR1)
   04151 PI3K-Akt signaling pathway
    100662289 (FGFR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100662289 (FGFR1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100662289 (FGFR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100662289 (FGFR1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100662289 (FGFR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100662289 (FGFR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100662289 (FGFR1)
   05205 Proteoglycans in cancer
    100662289 (FGFR1)
   05230 Central carbon metabolism in cancer
    100662289 (FGFR1)
  09162 Cancer: specific types
   05218 Melanoma
    100662289 (FGFR1)
   05215 Prostate cancer
    100662289 (FGFR1)
   05224 Breast cancer
    100662289 (FGFR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100662289 (FGFR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:lav04090]
    100662289 (FGFR1)
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100662289 (FGFR1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100662289 (FGFR1)
Protein kinases [BR:lav01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   100662289 (FGFR1)
CD molecules [BR:lav04090]
 Proteins
  100662289 (FGFR1)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100662289 (FGFR1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set FGFR3_TM Ig_5 C2-set_2 Ig_6 Ig_4 Pkinase_fungal DUF1615 DUF4611
Other DBs
NCBI-GeneID: 100662289
NCBI-ProteinID: XP_003412572
LinkDB
Position
Unknown
AA seq 820 aa
MWSWKCLLFWAVLVTATLCTARPAPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLVESNRTRITGEEVEVRDSVPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIIYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGK
PLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHK
NIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVS
CAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRL
PVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKP
SNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPD
TRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
NT seq 2463 nt   +upstreamnt  +downstreamnt
atgtggagctggaagtgcctcctcttctgggctgtgctggtcacagccacactgtgtact
gccaggccggccccaaccttgcctgaacaagctcagccctggggagcccctgtggaagtg
gagtccttcctggtccaccctggtgacctgctgcagcttcgctgtcggctgcgggacgat
gtacagagcatcaactggctgcgggacggggtacagctggtggaaagcaaccgtacccgc
atcacgggggaggaggtagaggtgcgggattccgtgcccgccgactctggcctctacgct
tgcgtgaccagcagcccctcgggcagcgacaccacctacttctccgtcaatgtctcagat
gctctcccctcctcggaggacgacgacgatgatgatgactcctcttcagaggagaaagag
acagataacaccaaaccaaaccgtatgcccgtggctccatattggacttccccagaaaag
atggaaaagaagttgcatgcagtgccagctgccaagacagtgaagttcaaatgcccttcc
agtgggacccctaaccccacactgcgctggttgaaaaatggcaaagaattcaaacctgac
cacaggattggaggctataaggtccgttatgccacctggagcatcataatggattccgtg
gtgccctctgataaaggcaactacacctgcattgtggagaatgagtacggcagcattaac
cacacctaccaactcgacgttgtggagcggtcccctcaccggcccatactgcaggcaggg
ttgcctgccaacaagacagtggccctgggcagcaatgtggagttcatgtgtaaggtgtac
agtgacccacagccccacatccagtggctaaagcacatcgaggtgaatgggagtaagatc
ggtccggacaacctgccttacgtccagatcttaaagactgccggagttaataccaccgac
aaagagatggaagtgcttcacttaaggaatgtctcctttgaggacgcgggggagtataca
tgcttggcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaa
gccctggaggagagaccggcagtgatgacctcgcccctgtatctggagatcatcatctat
tgtacgggggccttcctcatctcctgcatggtggggtctgtcatcatttacaagatgaag
agtggcaccaagaagagcgacttccatagccagatggccgtgcataagctggccaagagc
atccctctgcgcagacaggtgtcagctgactccagtgcatccatgaactctggggttctg
ctggttcggccctcgcgtctctcctccagcggaacccccatgctggctggggtctctgaa
tatgagcttcctgaagaccctcgctgggagctccctcgagacagactggttctaggcaaa
cccctgggagagggctgctttggacaggtggtgttggctgaagccatcgggctggacaag
gacaaacccaaccgtgtgaccaaagtggctgtgaagatgttgaagtcggacgcaacagag
aaagacctgtcagacctgatctcagaaatggagatgatgaagatgattggcaagcacaag
aacatcatcaacctgctgggggcctgcacgcaagacggtcctttgtacgtcattgtagaa
tatgcctccaagggcaacctacgggaatatctgcaggcccgaaggcctcctgggctggaa
tactgttacaaccccagccacaacccagaggagcagctctcctccaaggacctggtatcc
tgtgcctatcaggtggcccgaggcatggagtatcttgcctctaagaagtgcatacaccga
gacctggccgccaggaatgtcctggtgacagaggacaatgtgatgaagattgctgacttt
ggcctagccagggacattcaccacattgactactataaaaagacgaccaatggccgactg
ccagtgaagtggatggcgcctgaggcattgtttgaccggatctacacccaccagagtgat
gtgtggtccttcggggtgcttctgtgggaaatcttcactctgggtggctccccatatcct
ggtgtgcctgtggaggagcttttcaagctgctgaaggagggtcatcgtatggacaagccc
agtaactgcaccaatgagctgtatatgatgatgcgggactgctggcacgcagtaccctct
caaagacctaccttcaagcagctggtggaagacctggaccgcattgtggccttgacttcc
aatcaggagtatctggacttgtcaatgcccctggaccaatactctcccagctttcccgac
acccgaagctctacctgttcctcaggggaggattctgtcttctctcacgagccgttgcct
gaggagccctgtctgccccgacatccagcccagcttgccaatggcggactcaaacgacgc
tga

DBGET integrated database retrieval system