KEGG   Loxodonta africana (African savanna elephant): 100662336
Entry
100662336         CDS       T04351                                 

Gene name
PARD3
Definition
(RefSeq) partitioning defective 3 homolog isoform X11
  KO
K04237  partitioning defective protein 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04062  Chemokine signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04144  Endocytosis
lav04360  Axon guidance
lav04390  Hippo signaling pathway
lav04520  Adherens junction
lav04530  Tight junction
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100662336 (PARD3)
   04390 Hippo signaling pathway
    100662336 (PARD3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100662336 (PARD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100662336 (PARD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100662336 (PARD3)
   04530 Tight junction
    100662336 (PARD3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100662336 (PARD3)
  09158 Development and regeneration
   04360 Axon guidance
    100662336 (PARD3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100662336 (PARD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100662336 (PARD3)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100662336 (PARD3)
SSDB
Motif
Pfam: Par3_HAL_N_term PDZ PDZ_2 PDZ_6 TPR_11
Other DBs
NCBI-GeneID: 100662336
NCBI-ProteinID: XP_003420757
LinkDB
Position
Unknown
AA seq 1306 aa
MKVTVCFGRTRVVVPCGDGNMKVFNLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILD
VDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQ
ATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDNNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPMVDKWLEKQEQDE
DGTEEDNGRVEPVGHADTGLENMPSFSLDDMVKLVQVPNDGGPLGIHVVPFSARGGRTLG
LLVKRLEKGGKAEQENLFHENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPA
ANKEQYEQLSQSEKNNYYSGHFSPDSQYIDNRGVHGAGLHAVPRVPRLNQHEQIDSYPRL
PHSANPTGKPPSALAPAPQNAFNTNVSSGYNTKKIGKRLNIQLKKGTEGLGFSITSRDVT
IGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLAGKSQEEVVSLLRSTKMEGTVS
LLVFRQEDAFHPRELKAEDEDVVLTPDGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENH
ADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRRSMSTEGNKRG
MIQLIVARRINKCNELKSPGSPPGPELPIETVLDDRERRISHSLYSGIEGLDESPTRNAA
LSRIMGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDHSSSSSRDDVGFTMTDPGAWAT
AAISDSAECSLSPDVDPVLAFQREGFGRQIADETKVNTVDDQKAGSPSRDVGPSLGLKKS
SSLESLQTAVAEVTLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMET
LEEDTEESSRSGRESVSTASDQPSHSLERQINGNQEKGDKADRRKDKTVKEKKKDRDKEK
DKIKAKKGMLKGLGDMFRFGKHRKDDKIEKTGKIKVQEALTSEEERMRMKQEQERIQAKT
REFRERQARERDYAEIQDFHRTFGCEDDLMFGGMPSYDGSMARPQSPREGHMMDALYAQV
KKPRNSKPSPVDSNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQPWPNSKPYA
QSGRHSVSVEVQMQRQRQEERESFQQAQRQYSSLPRQSRKNASSVSQDSWEQNYAPGEGF
QSAKENPRYSSYQGSRNGYMGGHGFNARVMLETQELLRQEQRRKEQQMKKKPPPEGPNNY
DSYKKVQDPNYTPPKGPFRQDVPPSPSQVARLNRLQTPEKGRPFYS
NT seq 3921 nt   +upstreamnt  +downstreamnt
atgaaagtgacggtgtgtttcgggaggacccgggtggtcgtgccgtgcggagacggcaac
atgaaagttttcaacctcatccagcaagcggtgacccgctacaggaaggccatcgccaag
gatccaaactactggatacaggtgcatcgattggaacacggggatggagggatactagac
gtcgatgacattctctgtgatgtagcagatgataaagaccggctggtagctgtgtttgat
gagcaagatccacatcatggaggtgatggcaccagtgccagctccaccggcacccagagt
ccggagatatttggaagtgagctgggcaccaacaatgtttcagcctttcagccttatcaa
gcaacaagtgaaattgaggtcacaccctccgtccttcgtgcgaatatgcctcttcatgtc
cggcgaagcagtgacccagctttaattggtctctcgacttctgtcagcgataataatttt
tcatctgaagaaccgtctcggaaaaacccgacacgctggtctacaacagctggcttcctc
aagcagaacactgctggcagccccaaaacctgtgataggaagaaagatgaaaactaccga
agcctcccacgggatactagtaactggtctaaccaatttcagagagacaatgctcgctcc
tctctgagtgccagtcatccgatggtggacaagtggctggagaagcaagagcaggatgag
gatgggacagaagaagacaatggccgtgttgaaccagttggacatgctgacactggtttg
gagaatatgcccagcttctctctggatgatatggtaaagctcgtacaagttcccaacgat
ggagggcctctggggatccatgtagtgcctttcagtgctcgaggcggcagaaccctgggg
ttgttagtaaagcgattggagaaaggtggtaaagctgaacaggaaaacctttttcatgag
aacgattgcattgtcaggattaatgatggcgaccttcgaaacagaagatttgaacaagca
caacatatgtttcgccaagccatgcgtacacccatcatttggttccatgtggttcctgca
gcaaataaagagcagtatgagcaactatcccaaagtgagaagaataattactattccggc
cacttcagccccgacagccagtacattgataacaggggtgtacatggtgcaggacttcac
gcagtacccagagtgcccagactgaatcagcacgagcagatagactcttacccacgacta
cctcatagtgccaaccccaccgggaaaccgccgtcagctctggctccagcaccacaaaat
gcatttaatacgaatgtaagcagtggttataacaccaaaaaaattgggaagagacttaat
atccagcttaaaaaaggtacagaaggtttaggatttagcatcacttcccgagatgtaaca
ataggtggctcagctccaatttacgtgaaaaacattcttccaagaggggctgccattcaa
gatggcagactcaaggcaggggatagactcatagaggtaaatggagtcgatttagcaggc
aaatcccaagaggaagttgtttccctgttgagaagcaccaagatggaagggactgtgagc
cttctggtctttcgccaggaagacgccttccacccaagggaactgaaagctgaagatgag
gatgttgttctcacgcctgatggcaccagggagtttctcacgtttgaagttccacttaat
gattcaggatcggctggtctcggtgtcagtgtcaaagggaaccggtccaaagagaaccat
gcggacctggggatctttgtcaagtccatcattaacggaggagcagcgtctaaagatgga
aggcttcgggtgaatgatcaactgatagcagtgaatggagaatccctgttgggcaagaca
aaccaagatgctatggaaaccctgagaaggtctatgtccacggaaggaaacaaacgagga
atgatccagcttattgtagccaggcgaataaacaagtgcaatgagctcaagtcacctggg
agcccccccggacctgagctgcccattgaaaccgtgctggatgacagagaacggagaatt
tcccattccctctacagtgggatagaggggctggatgaatcacccacgagaaatgctgcc
ctcagtcggataatgggtaaataccagctgtcccccacagtgaatatgccccaagatgac
actgtcattatagaagatgacaggttgccagtccttcctccacatctctctgaccactcg
tcttctagctcccgtgatgatgtgggattcacaatgacagaccccggtgcgtgggccaca
gccgcaatcagtgactctgcagaatgctctttgagccccgatgtcgatccagtgctcgct
tttcagcgagaaggatttggacgccagatagctgacgagactaaagtcaatacagtggat
gaccagaaagcaggttctccgagcagagatgtaggaccttcactgggtctgaagaagtcg
agctcgttggaaagtctgcagacagcagttgctgaggtgactttgaatggggatattcct
ttccaccgtccccgaccccggattatccgaggcagggggtgcaatgagagcttcagagct
gcaatcgacaaatcttatgacaaacctgctgtagatgacgatgatgaaggcatggagacc
ttggaagaagacacagaagaaagttcaagatctgggagagagtctgtatccacagccagt
gaccagccttcccactccctggagagacagatcaatggaaaccaagagaaaggtgataag
gctgacagaagaaaggataaaactgtaaaagagaagaagaaagatagagacaaagaaaag
gataaaattaaagccaagaagggaatgctgaagggtttgggagacatgttcaggtttggc
aaacatcgaaaagatgacaagattgagaaaacgggtaaaataaaagtacaggaagccctt
acttcagaagaggagaggatgcgaatgaagcaggaacaggagaggattcaagctaaaact
cgagaatttagagagcggcaagcccgagagcgtgactatgctgaaatccaagactttcat
cggacgtttggctgtgaagacgatttgatgtttgggggaatgccttcgtatgacggttcc
atggccagaccccagagcccgagagaagggcatatgatggatgctttgtacgcccaggtg
aagaagcctcggaattccaaaccgtcacctgtagacagcaacagatccactcctagcaac
catgatcggatacagcgtctgaggcaagaatttcaacaggcaaagcaggatgaagatgta
gaagaccggcgacgtacctacagctttgaacaaccctggccaaattccaagccatatgcg
cagagtggcaggcactccgtgtccgtggaggtccagatgcagcggcagcgccaggaggag
cgggagagtttccagcaagcccagcgccagtacagctctctgcctcggcaaagccggaaa
aacgccagttctgtctcccaggattcttgggagcagaactacgcccctggggaaggcttc
cagagtgccaaggagaaccccaggtactccagctaccaagggtcgaggaatggctacatg
ggcgggcacggcttcaatgcgagggtgatgctggagacccaggagctcctgcgccaggaa
cagaggcggaaagagcaacagatgaagaagaagcctcctcctgaggggcccaacaattat
gactcgtataagaaagtccaggaccccaactacacccctcccaagggtcccttccggcaa
gacgtgcccccctcgccttctcaggttgccaggctgaacagactgcagactcctgagaaa
gggaggcccttttattcctga

DBGET integrated database retrieval system