KEGG   Loxodonta africana (African savanna elephant): 100662363
Entry
100662363         CDS       T04351                                 

Gene name
ADCYAP1
Definition
(RefSeq) pituitary adenylate cyclase-activating polypeptide
  KO
K05262  pituitary adenylate cyclase-activating polypeptide
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04713  Circadian entrainment
lav04911  Insulin secretion
lav04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100662363 (ADCYAP1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100662363 (ADCYAP1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100662363 (ADCYAP1)
   04924 Renin secretion
    100662363 (ADCYAP1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100662363 (ADCYAP1)
SSDB
Motif
Pfam: Hormone_2
Other DBs
NCBI-GeneID: 100662363
NCBI-ProteinID: XP_003406425
UniProt: G3TD45
LinkDB
Position
Unknown
AA seq 176 aa
MTMCSGASLALLVYGIIMHSSVYCSPAAAGLRFPGIRPEDEVYDEDGNPLQDYYDSDPPG
LGSPASALHDSSALYYPAEKRDVARGILNKAYRKVLDQLSARKYLQSLLAKGLGGDLGGS
AEDDSEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
NT seq 531 nt   +upstreamnt  +downstreamnt
atgaccatgtgtagcggagcgagcctggccttgctggtctacgggataataatgcacagc
agtgtctactgctcacctgccgccgccggactgcggttccccgggattaggccggaggac
gaggtgtacgacgaggacggaaacccactgcaagactattatgattcggacccgcccggc
ctagggagccccgcctccgcgctgcacgactcctccgcgctctactaccctgcggagaag
agagatgtcgcccgagggatccttaacaaggcctaccgaaaagtgctggaccagctgtcc
gccaggaagtacctgcagtcgcttttggccaagggtctgggtggggacttaggcggcagc
gcagaggacgactcggagccgctctccaagcgccactcagacggaatcttcacggacagc
tacagccgctaccggaaacaaatggcagtcaaaaaatacttggcggccgtcctagggaaa
aggtataaacagagggttaaaaacaagggacgccgaatagcgtatttgtag

DBGET integrated database retrieval system