KEGG   Loxodonta africana (African savanna elephant): 100662461
Entry
100662461         CDS       T04351                                 

Gene name
GRM8
Definition
(RefSeq) LOW QUALITY PROTEIN: metabotropic glutamate receptor 8
  KO
K04610  metabotropic glutamate receptor 8
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04072  Phospholipase D signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100662461 (GRM8)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100662461 (GRM8)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100662461 (GRM8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100662461 (GRM8)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100662461 (GRM8)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100662461 (GRM8)
G protein-coupled receptors [BR:lav04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   100662461 (GRM8)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6
Other DBs
NCBI-GeneID: 100662461
NCBI-ProteinID: XP_003407294
LinkDB
Position
Unknown
AA seq 908 aa
MVCEGKRSASCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRMDGDIILGGLFPIHAKGER
GVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFV
QALIEKDAYDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTA
PELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISR
EIGGVCIAQSQKIPREPRPGEFEKIIRRLLETPNARAVIMFANEDDIRRILEAAKKLNQS
GHFLWIGSDSWGSKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFA
EFWEENFGCKLGSHGKRNSHIKKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNLH
KDLCPGYVGLCPRMSTVDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQITN
KSTEYKIIGHWTNQLHLKVEDMQWANREHAHPASVCSLPCKPGERKKTVKGVPCCWHCER
CEGYNYQVDELSCELCPLDQRPNINRTGCQLIPIIKLEWHSPWAVAPVFIAILGIIATTF
VIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRIFLGLGMC
FSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISIQLLGVFVWFVVDPPH
IIIDYGEQRTLDPENARGVLKCDISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEA
KPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYI
IIFHPEQNIQKRKRSFKAVVTAATMQSKLIQKGNDRPNGEVKSELCESLETNTSSTKTTY
ISYSNHSI
NT seq 2727 nt   +upstreamnt  +downstreamnt
atggtatgcgagggaaagcgctcagcctcttgcccttgtttcttccttctgaccgccaag
ttctactggatcctcaccatgatgcaaagaactcacagccaggagtatgcccattccata
cgcatggatggggacatcattttggggggtctgttcccgatccatgcaaagggagagaga
ggggtgccttgtggagagctgaagaaggaaaagggaatccacaggctcgaggccatgctt
tatgcaattgaccagattaataaggatcctgatctcctgtccaacatcacactgggtgtc
cgaatccttgacacgtgctcccgggacacctatgctttggagcagtcgctgacgttcgtg
caggctttaatagagaaagatgcttatgatgtgaagtgtgcaaatggagacccgcccatt
ttcaccaagcctgacaagatttctggcgtcataggtgctgcagcaagctccgtgtccatc
atggttgctaacattctaagactttttaagatacctcaaatcagctatgcatccacagcc
ccagagctaagtgataacaccaggtatgactttttctctcgggtggtcccacctgactcc
taccaagcacaagccatggtggacattgtgacggccctgggatggaattacgtgtcaacg
ctggcttccgaggggaactacggagagagcggtgtggaggccttcacccagatctccagg
gagattggtggtgtttgtattgctcaatcgcagaaaattcctcgtgaaccaagacctgga
gaatttgaaaaaatcatccgacgcctgctagaaacacctaacgctcgggcagtgattatg
tttgccaacgaggatgacatcaggaggatattggaggcagcaaaaaaattaaaccaaagt
gggcattttctctggattggttcagatagttggggatccaaaattgcacctgtctaccag
caggaggagattgcagaaggggctgtgacgattttgcccaaaagagcatcaattgatggg
tttgatcgatactttaggagtcgcactcttgccaataatcgaagaaatgtgtggtttgcg
gaattctgggaggagaattttggatgcaagttaggatcacatggaaaacggaacagtcat
ataaagaaatgcacagggctggagcgcattgcgcgggactcctcttatgaacaggaagga
aaggtccaatttgtaatagacgctgtgtattccatggcctacgcccttcacaatctgcac
aaggatctctgcccagggtacgttggcctgtgtcctcggatgagcaccgttgatgggaaa
gagttacttggttacattcgggctgtaaattttaatggtagtgctggaacacctgttact
tttaatgaaaatggagacgctcctggacgttatgacatcttccagtatcagataaccaac
aaaagtacagagtacaaaatcatcgggcactggaccaatcagcttcatctgaaagtagaa
gacatgcagtgggctaacagagagcacgctcacccggcgtctgtctgcagcctgccatgt
aagcctggggagaggaagaaaacggtgaagggagtcccttgctgctggcactgtgagcgc
tgtgaaggttacaattaccaggtggatgaactctcctgtgaactttgccctttggatcag
aggcccaacatcaaccgcacaggctgccagcttatccccatcatcaagttggagtggcat
tctccctgggccgtggcgccggtgttcattgccatactggggatcatcgccaccacattt
gtgatcgtgacctttgtccgctataatgacacacctattgtgagagcttcaggacgggag
cttagttatgtgctcctcacggggatttttctctgttattcaatcacctttttaatgatc
gcagcaccagatacaatcatctgctccttccgacggatcttcctgggactcggcatgtgt
tttagctatgcagcccttcttaccaaaaccaaccgaatccaccgaatatttgagcagggg
aagaaatcagtcactgcacccaagtttattagtccagcatcccagctggtgatcaccttc
agcctcatctccatacagctccttggggtgtttgtctggtttgtggtggatcccccccac
atcatcattgactatggagagcagcggacactggacccggagaacgccaggggagtgctc
aaatgtgacatttctgacctctcgctcatttgttcccttggatacagtatcctcttgatg
gtcacttgtactgtttatgccattaaaacgagaggtgtcccagagactttcaatgaagcc
aaacctattggattcaccatgtataccacctgcatcatttggttagctttcattcccatc
ttttttggcacagcccagtcagcagaaaagatgtacattcagacaacaacactcactgtc
tccatgagtttaagtgcttcggtgtctctgggcatgctttatatgcccaaggtttatatt
ataatttttcaccccgagcagaacattcagaaacgcaagaggagcttcaaggctgtggtc
acagctgccaccatgcaaagcaaactgatccaaaaaggaaacgacagaccaaatggcgag
gtgaaaagtgaactctgtgagagtcttgaaaccaacacttcctctaccaagaccacatat
atcagctacagcaatcactcaatctga

KEGG   Loxodonta africana (African savanna elephant): 100664172
Entry
100664172         CDS       T04351                                 

Gene name
GRM7
Definition
(RefSeq) metabotropic glutamate receptor 7 isoform X1
  KO
K04609  metabotropic glutamate receptor 7
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04072  Phospholipase D signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100664172 (GRM7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100664172 (GRM7)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100664172 (GRM7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100664172 (GRM7)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100664172 (GRM7)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100664172 (GRM7)
G protein-coupled receptors [BR:lav04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   100664172 (GRM7)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6 DUF2318
Other DBs
NCBI-GeneID: 100664172
NCBI-ProteinID: XP_003409824
LinkDB
Position
Unknown
AA seq 922 aa
MVQRGKLLRVLTLMKFPCCVLEVLLCALAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAK
GPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSL
TFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYA
STAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQ
ISKEAGGLCIAQSVRIPQERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAK
RADQVGHFLWVGSDSWGSKINPLHQHEDIAEGAITIQPKRATVEGFDAYFTSRTLENNRR
NVWFAEYWEENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAH
ALHHMNKDLCADYRGVCPEMEHAGGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIF
QYQTTNTTNPGYRLIGQWTDELQLNIEDMQWGKGVREIPASVCTLPCKPGQRKKTQKGTP
CCWTCEPCDGYQYQFDEMTCQHCPYDQRPNENRTGCQDIPIIKLEWHSPWAVIPVFLAML
GIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRV
FLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQLLGVFIW
FGVDPPNIIIDYDEHKTMNPDQARGVLKCDITDLQIICSLGYSILLMVTCTVYAIKTRGV
PENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGML
YMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNN
CIPPVRKSVQKSVTWYTIPPTV
NT seq 2769 nt   +upstreamnt  +downstreamnt
atggtccagcggggaaagctgctccgcgtcctgactttgatgaagttcccctgctgcgtg
ttggaggtgctcctgtgcgcgctggcggcggcggcgcgcggtcaggagatgtacgccccg
cactcgattcggatcgagggggacgtcacccttggggggctgttccccgtgcacgccaag
ggtcccagcggagtgccctgcggcgacatcaagagggagaacgggatccacaggctggaa
gcgatgctctacgccttggaccagatcaacagcgatcccaacctgctgcccaacgtgacg
ctaggcgcgcggatcctggacacttgttccagggacacttatgcgctcgagcagtcgctc
actttcgtccaagcgctcatccaaaaggacacctccgacgtgcgctgcaccaacggcgag
ccccccgtattcgtcaagcctgagaaagtagttggagtgattggggcttcggggagttcc
gtctccatcatggtagccaacatcctgaggcttttccagatcccccagattagttatgca
tcaacggcacctgagttaagtgacgaccggcgctatgacttcttctcccgcgtggtccca
cccgattccttccaagcccaggccatggtagacattgtaaaggccctaggctggaattat
gtgtctactcttgcatctgaaggaagttatggagagaaaggtgtggaatccttcacgcag
atttccaaagaggcaggtgggctctgcattgcccagtccgtgagaatcccccaagagcgc
aaagacaggaccattgactttgatagaattatcaaacagctcctggacactcccaactcc
agggccgtcgtgatttttgccaacgatgaggatataaagcagatccttgcagcagcaaaa
agagctgaccaagtgggtcattttctttgggtgggatcagacagctggggatccaaaatc
aacccactacaccagcatgaagatattgcagaaggcgccatcaccattcagcccaagaga
gcaactgttgaagggtttgatgcctactttacatcccgcacacttgaaaacaacagaaga
aatgtatggtttgctgaatactgggaagaaaacttcaactgcaagttgacgattagtggg
tcaaaaaaagaagacacagatcgcaaatgcacagggcaggagagaattgggaaagattcc
aactatgagcaggaggggaaggttcagttcgtgattgatgcagtctatgccatggcccat
gcccttcatcacatgaacaaggacctctgtgctgactaccggggggtctgtccagagatg
gagcatgccgggggcaagaagttgttgaagtatatccgcaatgttaacttcaatggtagt
gctggcaccccagtaatgtttaacaagaatggggatgcacctggacgttatgacatcttt
cagtaccagacgacaaacaccaccaaccctggttaccgcctaattggacagtggacagac
gagcttcagctcaatatagaggacatgcagtggggtaaaggggtccgggagatccccgcc
tctgtgtgcacactaccatgtaagcctgggcaacgaaagaagacacagaagggtacccct
tgctgctggacctgtgagccctgcgatgggtaccagtaccagtttgatgagatgacctgc
cagcactgcccctacgaccagcggcccaacgaaaaccgaacaggctgccaggacatcccc
atcataaaactggagtggcattccccctgggctgtcatcccagtgttccttgcaatgttg
ggcatcatcgccaccatctttgtcatggccacattcatccgctacaatgacacgcccatt
gtccgggcttccggccgggaactcagttatgttctgttgacgggcatcttcctttgctac
attatcactttcctgatgatcgccaaacccgatgtggcagtgtgttcttttcggcgagtt
ttcctgggcttgggaatgtgcataagttatgcagcccttttgacaaagaccaatcggatt
tatcgcatatttgagcagggcaagaaatctgtgactgctcccagactcataagcccaaca
tcacagctggcaatcacttccagtttaatatcagttcagctcttaggtgtttttatttgg
tttggtgttgacccaccgaacatcatcatagactatgatgaacataagacaatgaaccct
gaccaggccagaggagttctcaaatgtgacattacagatctccaaattatttgctccttg
ggatatagcattcttctcatggtcacatgtactgtgtatgccatcaagactcggggtgtc
ccagagaattttaatgaagccaagcccattggattcactatgtacacgacttgtatagta
tggctagccttcattccaattttttttggcaccgctcagtcagcagaaaagctctacata
caaactaccacacttacaatctccatgaacctaagtgcgtcagtggcgctggggatgcta
tacatgccgaaagtgtacatcatcattttccaccccgagctcaatgtccagaaacggaag
cgaagcttcaaggcggtagtcacagcagccaccatgtcatcgcggctgtcacacaaaccc
agtgacagacccaatggtgaggcaaagacagaactctgtgaaaacgtagacccaaacaac
tgtataccacctgtaagaaagagtgtacaaaagtctgttacttggtacactatcccacca
acagtatag

DBGET integrated database retrieval system