KEGG   Loxodonta africana (African savanna elephant): 100662470
Entry
100662470         CDS       T04351                                 

Gene name
CHAT
Definition
(RefSeq) choline O-acetyltransferase isoform X1
  KO
K00623  choline O-acetyltransferase [EC:2.3.1.6]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100662470 (CHAT)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100662470 (CHAT)
Enzymes [BR:lav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.6  choline O-acetyltransferase
     100662470 (CHAT)
SSDB
Motif
Pfam: Carn_acyltransf
Other DBs
NCBI-GeneID: 100662470
NCBI-ProteinID: XP_023402935
LinkDB
Position
Unknown
AA seq 642 aa
MPILEKVPHQTVAKPASGAEEVLDLPKLPVPPLQQTLATYLRCMRHLVPEEQFRKSQAIV
QRFGDPDGLGEALQQKLLERREKTANWVSEYWLNDMYLNNRLALPVNSSPALIFARQHFQ
DTNDQLRFAANLISGVLSYKALLDSHSLPTDCAKGQLAGQPLCMRQYYGLFSSYRLPGHT
QDTLVAQKSSVMPEPEHIIVACRNQFFVLDVVINFRRLSEGDLFTQLGKIVKMASNEDER
LPPIGLLTSDGRTEWAEARTVLMKDSTNRDSLDMIERCICLVCLDTPGGVELSDPNMALQ
LLHGGGCSKNGANRWYDKSLQFVVGRDGVCGVVCEHSPFDGIILVQCVEHLLKHVKKSTQ
KLVRADSVSELPAPRRLRWKCSPEIQGHLASSAEKLQRIVKNLDFTVHNFNYYGKTFMKQ
QKCSPDAFLQVALQLAFYRCHGRLMPTYESASIRRFQEGRVDNIRSATPEALAFVKAMTD
HTAATSDSEKLLLFKDAIRAQTEYTVMALTGMAIDNHLLALRELAREVCQELPEMFTEET
YLMSNHFVLSTSQVPTTMEMFCCYGPVVPDGYGACYNPQPENILFCISSFHSCKETSSTK
FAKAVEESLLAMRELCLLPPPAADKPQAAKEKATRPSPDSFC
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgcccatcctggagaaagtcccccatcagacggtggcaaaacctgccagtggtgcagag
gaagtccttgacctacccaaattgccagtgccccctctgcaacagaccttggccacctac
ctgcggtgcatgcggcacctggtgcctgaggagcagtttaggaagagccaggccatcgtg
cagcggtttggggaccctgatggcctcggtgaggccctgcagcagaagcttctggagcgg
cgggagaagacggccaactgggtgtctgagtactggctgaacgacatgtatcttaataac
cgcctggccctgcctgtcaactccagcccagctttgatctttgcacggcagcacttccag
gataccaacgaccagctaaggtttgcggccaacctcatctccggtgtgctcagctacaag
gcgctgctggacagccactcactccccaccgactgtgccaagggtcagctggcagggcag
cccctctgtatgaggcagtactatgggcttttctcctcctaccggctccctggccacacc
caggacacgctggtggcccagaagagcagtgtcatgcctgagcctgagcacatcatcgtg
gcttgccgaaaccagttctttgtcttagatgttgtcattaatttccgccgtctcagtgag
ggggatctgttcactcagttgggaaagatagtcaaaatggcttccaacgaggacgagcgc
ttgcctccaatcggcctgctgacgtcagacgggaggaccgagtgggccgaggccaggact
gtcctcatgaaagactccaccaaccgagactcactggatatgattgagcgttgtatctgc
ctggtgtgcctggacaccccagggggtgtggagctcagcgatcccaacatggccctccag
ctcctccatggtggaggctgcagcaagaatggggcgaatcgctggtatgacaagtccttg
cagtttgtggtgggcagggacggggtctgtggcgtggtgtgtgagcactccccttttgac
ggcatcatcctggtgcagtgcgtggagcacctgctcaagcacgtgaagaaaagcacccag
aagctggtccgagccgactccgtcagtgagctcccagcccccaggaggctccggtggaaa
tgctcccccgaaattcaaggccacctagcctcctctgcagaaaagcttcaacggatcgtg
aagaaccttgacttcactgttcataacttcaactactatgggaaaacattcatgaagcag
cagaaatgcagccccgatgccttccttcaggtggccctccaactggccttctacaggtgc
cacgggagactcatgcccacctatgagagtgcgtccattcgccgattccaggaggggcgg
gtggacaacatccgatcagctactccagaagccctggcttttgtgaaggccatgactgac
cacacggcagccacctcggattcagagaagctgctgctcttcaaggatgccatccgtgcg
cagactgagtacacagtcatggccttaacaggcatggccatcgacaaccacctgctggcg
ctgcgggagctggcccgggaagtgtgccaggagctgccggagatgttcacggaggaaacg
tacttgatgagcaaccattttgtcctctccaccagccaggtgcccactactatggagatg
ttttgctgctatggtcctgtggtccccgacgggtatggtgcctgctacaacccacagcca
gagaacatccttttctgtatctccagcttccacagctgcaaagagacctcttctaccaag
tttgcaaaagcggtggaagaaagcctgcttgcaatgcgagagctctgcctcctgccccct
cctgctgcggacaagccgcaggcagccaaggaaaaggccaccaggcctagccctgactcc
ttctgctag

DBGET integrated database retrieval system