KEGG   Loxodonta africana (African savanna elephant): 100662471
Entry
100662471         CDS       T04351                                 

Gene name
PRKG1
Definition
(RefSeq) cGMP-dependent protein kinase 1 isoform X1
  KO
K07376  cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04270  Vascular smooth muscle contraction
lav04540  Gap junction
lav04611  Platelet activation
lav04713  Circadian entrainment
lav04714  Thermogenesis
lav04730  Long-term depression
lav04740  Olfactory transduction
lav04923  Regulation of lipolysis in adipocytes
lav04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100662471 (PRKG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100662471 (PRKG1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100662471 (PRKG1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100662471 (PRKG1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100662471 (PRKG1)
  09154 Digestive system
   04970 Salivary secretion
    100662471 (PRKG1)
  09156 Nervous system
   04730 Long-term depression
    100662471 (PRKG1)
  09157 Sensory system
   04740 Olfactory transduction
    100662471 (PRKG1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100662471 (PRKG1)
   04714 Thermogenesis
    100662471 (PRKG1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100662471 (PRKG1)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  PKG family
   100662471 (PRKG1)
SSDB
Motif
Pfam: Pkinase cNMP_binding PK_Tyr_Ser-Thr Kinase-like Med4 Med28 APH Pkinase_C Spc7 Tsc35 PKcGMP_CC
Other DBs
NCBI-GeneID: 100662471
NCBI-ProteinID: XP_003409303
LinkDB
Position
Unknown
AA seq 686 aa
MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQA
QKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMK
NLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKV
FGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSL
PEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGKVNVTREDSPSEDPVFLRTLG
KGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKY
EAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEH
IRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYT
ACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYV
APEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIVK
NAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTD
TSNFDSFPEDSDEPPPDDNSGWDIDF
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgggcaccctgcgggatttacaatacgcgctccaggagaagattgaggagctgaggcag
cgggatgctctcatcgacgagctggagctggagttggatcagaaggacgaactgatccag
aagctgcagaacgagctggacaagtaccgctcggtgatccggccggccacccagcaggcg
cagaagcagagcgctagcaccttgcagggtgagccgcgcaccaagcggcaggcgatctcc
gctgaacccaccgccttcgacatccaagatctcagccatgtgaccctgcctttctaccct
aagagtccacagtcgaaggatctcataaaggaagccatccttgacaatgactttatgaag
aacttggaactgtcccagatccaggagattgtggattgtatgtacccagtggagtatggc
aaagacagttgcatcatcaaagaaggagatgtggggtcactggtgtatgtcatggaagat
gggaaggttgaagttacaaaagaaggtgtgaagctgtgcaccatgggtccaggaaaagtg
tttggggagttggctattctttacaactgtacccggacagcgaccgtcaagactcttgta
aatgtgaaactctgggccattgatcgacaatgttttcaaacaataatgatgagaacaggg
ctcatcaagcacaccgagtatatggaatttttaaaaagcgttccaacattccagagcctt
cctgaagagatcctcagtaagcttgctgatgtccttgaagagactcactatgaaaatgga
gaatatattatcaggcaaggtgcaagaggagacaccttctttatcatcagcaaaggaaag
gtaaatgtcacacgagaagactcaccaagcgaagacccagtttttctgcgaactttagga
aaaggagattggtttggagagaaagcccttcagggggaagatgtaagaacagcaaatgta
attgccgcagaagctgtaacctgccttgtgatcgacagagactctttcaagcatttgatt
ggagggttggatgatgtatctaataaagcatatgaagacgcagaagctaaagcaaaatat
gaagctgaagctgctttcttcgccaacctgaagctgtctgatttcaacatcatcgacacc
cttggagttggaggtttcggacgagtagaactggtccagttgaaaagtgaagagtccaaa
acatttgctatgaagattctcaagaaacgccacattgtggataccagacagcaggagcac
atccgctcggagaagcagatcatgcagggtgctcattccgacttcatcgtcagactatac
agaacattcaaggacagcaaatatttgtacatgttgatggaagcttgcctaggtggagaa
ctctggaccattctcagggatagaggttcatttgaagattctacaaccagattttataca
gcatgtgtcgtagaagcttttgcctatctgcattccaaaggaatcatttacagggacctc
aagccagaaaacctcatcctagatcatcgaggttatgccaaactggttgattttggcttt
gcaaagaaaataggatttggaaagaaaacatggactttttgtggaactccagagtatgta
gccccagagatcatcctgaacaaaggtcatgacatttcagccgactattggtccctggga
attctaatgtatgaacttctgactggcagcccacctttctcaggcccagatcctatgaaa
acctataacatcatattgaggggaattgatatgatagaatttccaaagaagattgtcaaa
aatgctgctaatttaattaaaaaactatgcagggacaatccgtcagaaagattagggaat
ttgaaaaatggagtgaaagacattcaaaagcacaaatggtttgagggttttaattgggaa
ggattacgaaaaggcacgttgacacctcctataataccaagtgttgcatcacccacagac
acaagcaattttgacagtttccctgaggacagtgacgaaccaccacctgatgacaattca
ggatgggacatagacttctaa

DBGET integrated database retrieval system