KEGG   Loxodonta africana (African savanna elephant): 100662521
Entry
100662521         CDS       T04351                                 

Gene name
ATF4
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4 isoform X2
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04137  Mitophagy - animal
lav04141  Protein processing in endoplasmic reticulum
lav04151  PI3K-Akt signaling pathway
lav04210  Apoptosis
lav04211  Longevity regulating pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04668  TNF signaling pathway
lav04720  Long-term potentiation
lav04722  Neurotrophin signaling pathway
lav04725  Cholinergic synapse
lav04728  Dopaminergic synapse
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04915  Estrogen signaling pathway
lav04918  Thyroid hormone synthesis
lav04922  Glucagon signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04926  Relaxin signaling pathway
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04932  Non-alcoholic fatty liver disease
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav05010  Alzheimer disease
lav05012  Parkinson disease
lav05014  Amyotrophic lateral sclerosis
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05030  Cocaine addiction
lav05031  Amphetamine addiction
lav05034  Alcoholism
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05203  Viral carcinogenesis
lav05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100662521 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100662521 (ATF4)
   04668 TNF signaling pathway
    100662521 (ATF4)
   04022 cGMP-PKG signaling pathway
    100662521 (ATF4)
   04151 PI3K-Akt signaling pathway
    100662521 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100662521 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    100662521 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100662521 (ATF4)
   04922 Glucagon signaling pathway
    100662521 (ATF4)
   04912 GnRH signaling pathway
    100662521 (ATF4)
   04915 Estrogen signaling pathway
    100662521 (ATF4)
   04926 Relaxin signaling pathway
    100662521 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    100662521 (ATF4)
   04918 Thyroid hormone synthesis
    100662521 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    100662521 (ATF4)
   04925 Aldosterone synthesis and secretion
    100662521 (ATF4)
   04927 Cortisol synthesis and secretion
    100662521 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100662521 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    100662521 (ATF4)
   04728 Dopaminergic synapse
    100662521 (ATF4)
   04720 Long-term potentiation
    100662521 (ATF4)
   04722 Neurotrophin signaling pathway
    100662521 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    100662521 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100662521 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    100662521 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100662521 (ATF4)
   05012 Parkinson disease
    100662521 (ATF4)
   05014 Amyotrophic lateral sclerosis
    100662521 (ATF4)
   05020 Prion disease
    100662521 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    100662521 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    100662521 (ATF4)
   05031 Amphetamine addiction
    100662521 (ATF4)
   05034 Alcoholism
    100662521 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100662521 (ATF4)
   04934 Cushing syndrome
    100662521 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100662521 (ATF4)
   05161 Hepatitis B
    100662521 (ATF4)
   05163 Human cytomegalovirus infection
    100662521 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100662521 (ATF4)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    100662521 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF3450 Atg14 GAS Nop53 DUF4407 bZIP_Maf Baculo_F Fez1 Laminin_II AAA_13
Other DBs
NCBI-GeneID: 100662521
NCBI-ProteinID: XP_003419800
LinkDB
Position
Unknown
AA seq 353 aa
MAEMSFLSSEVLVGDLMSPFDQSGLGVEETLGLLDDYLEVAKHCRPHGFSRDKAKAGSSE
WLAVDGLVDASDNGKEDAFSGTDWMVEKMDLKEFDFDALLSLDDLEIMPAELLATLDDTC
DLLDPLVQETNEPPQTLNPIGHLPESFPQTDQVAPLTFLQPLPHCPGVLASTPDHSFSLE
LGSEVDISEGDRKADSFLYVTAVPQCIKEEEAPSDNDSGICMSPESCPGSPQHSPSTSGG
SPDRSLLSPPALGGSARPKPYDPPREKVVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKR
AEQEALTDECKELEKKNEALKERADSLAKEIQYLKDLIEEVRRARGKKRDSLG
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggccgagatgagcttcctgagcagcgaggtgttggtgggggacttgatgtcccccttc
gaccagtcgggtttgggggttgaagaaaccctaggtctcttagacgactacctggaggtg
gccaagcactgcagaccgcatgggttctccagggacaaggctaaggcgggctcctccgaa
tggctggctgtggacgggttggtcgatgcctcagacaacggcaaggaggatgccttctcc
ggaacagattggatggtggagaaaatggatctgaaggagtttgacttcgatgccctattg
agtctagacgacctggaaattatgccagccgagcttttggccacgttggatgacacctgt
gatctcttagaccctttagtccaggagacgaatgagcccccccagacattgaacccaatt
ggccatctcccagaaagttttccacaaactgaccaggttgccccattgaccttcctgcaa
cctctgccccattgccccggagtcctggcctccactccagaccattcttttagtttagag
ctcggcagtgaagtggatatttccgaaggagacagaaaggcagattcctttctgtatgtt
accgcggtccctcagtgcataaaagaggaggaggccccttcagataatgacagtggcatc
tgcatgagtcctgaatcctgtccaggatctccccagcacagcccctccacctctgggggc
tctccagataggagcttgctgtctccacctgctctcggtggctctgctcgccccaaacct
tatgatcctcctagagagaaggtggtagcagcaaaagtaaagggagagaaattggataag
aaactgaaaaaaatggagcagaacaagacagcagccactaggtaccgtcagaaaaagagg
gcagagcaggaggccctcacggatgagtgtaaggagctagaaaagaaaaacgaggctttg
aaggagagggcagattctctggccaaggagatccagtatctgaaagacttgatagaagag
gtccgcagggccagggggaagaaaagggattccctagggtag

DBGET integrated database retrieval system