KEGG   Loxodonta africana (African savanna elephant): 100662562
Entry
100662562         CDS       T04351                                 

Gene name
CA2
Definition
(RefSeq) carbonic anhydrase 2
  KO
K18245  carbonic anhydrase 2 [EC:4.2.1.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00910  Nitrogen metabolism
lav01100  Metabolic pathways
lav04964  Proximal tubule bicarbonate reclamation
lav04966  Collecting duct acid secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    100662562 (CA2)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    100662562 (CA2)
   04972 Pancreatic secretion
    100662562 (CA2)
   04976 Bile secretion
    100662562 (CA2)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    100662562 (CA2)
   04966 Collecting duct acid secretion
    100662562 (CA2)
Enzymes [BR:lav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     100662562 (CA2)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100662562 (CA2)
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 100662562
NCBI-ProteinID: XP_003408289
LinkDB
Position
Unknown
AA seq 260 aa
MSHHWGYGKHNGPEFWHESFPIAKGERQSPIDIDTKAAKYDPALKPLSISYEQATSRRIL
NNGHTFSVEFDDSQDKSVLKGGPLEGTYRLIQFHFHWGSSDEQGSEHTVDKKKYAAELHL
VHWNTKYGEFGKAVQHPDGLAVLGIFLKIGSANPGLQKVVDMLDSIKTKGKSAEFINFDP
RGLLPKSLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQMSKFRNLKFNEEGEPEEPM
VDNWRPVQPLKNRQIKASFT
NT seq 783 nt   +upstreamnt  +downstreamnt
atgtcccatcactggggatacggcaagcacaacgggccagagttctggcatgagagcttc
cccattgccaagggcgagcgccagtctcctattgacatcgataccaaagcagccaagtat
gaccctgccctgaagcctctgtccatttcctacgaacaagcgacttctcggaggatcttg
aacaatggtcacactttcagcgtggagtttgatgactctcaggacaaatcagtattgaaa
ggtggacccttggaaggcacttataggttgatacagtttcactttcactggggttcatct
gatgaacaaggttctgagcacactgtggacaaaaagaaatacgctgcagagcttcacttg
gttcattggaacacgaaatatggggaatttggaaaagccgtacaacaccctgatggactg
gcagttttggggatttttttgaagattggcagtgctaacccaggccttcagaaagtcgtt
gatatgctggattccattaaaacaaagggtaagagtgccgaattcattaactttgatcct
cgtggcctccttcccaaaagcttagactactggacctacccaggctcactgactacccct
ccacttctggagtgtgtaacctggattgtgctaaaggagcccatcagcgtcagcagtgag
cagatgtctaagttccgtaatcttaaattcaacgaggagggtgaacctgaagaaccgatg
gtggataactggcgtccagttcagccactgaaaaacaggcagatcaaagcttccttcaca
taa

DBGET integrated database retrieval system