KEGG   Loxodonta africana (African savanna elephant): 100662583
Entry
100662583         CDS       T04351                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2 isoform X2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav01524  Platinum drug resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04020  Calcium signaling pathway
lav04066  HIF-1 signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04520  Adherens junction
lav04530  Tight junction
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05215  Prostate cancer
lav05219  Bladder cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05226  Gastric cancer
lav05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100662583 (ERBB2)
   04012 ErbB signaling pathway
    100662583 (ERBB2)
   04066 HIF-1 signaling pathway
    100662583 (ERBB2)
   04020 Calcium signaling pathway
    100662583 (ERBB2)
   04151 PI3K-Akt signaling pathway
    100662583 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100662583 (ERBB2)
   04520 Adherens junction
    100662583 (ERBB2)
   04530 Tight junction
    100662583 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100662583 (ERBB2)
   05206 MicroRNAs in cancer
    100662583 (ERBB2)
   05205 Proteoglycans in cancer
    100662583 (ERBB2)
   05230 Central carbon metabolism in cancer
    100662583 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100662583 (ERBB2)
   05226 Gastric cancer
    100662583 (ERBB2)
   05219 Bladder cancer
    100662583 (ERBB2)
   05215 Prostate cancer
    100662583 (ERBB2)
   05213 Endometrial cancer
    100662583 (ERBB2)
   05224 Breast cancer
    100662583 (ERBB2)
   05223 Non-small cell lung cancer
    100662583 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100662583 (ERBB2)
   01524 Platinum drug resistance
    100662583 (ERBB2)
   01522 Endocrine resistance
    100662583 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100662583 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100662583 (ERBB2)
   04090 CD molecules [BR:lav04090]
    100662583 (ERBB2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100662583 (ERBB2)
Protein kinases [BR:lav01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100662583 (ERBB2)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100662583 (ERBB2)
CD molecules [BR:lav04090]
 Proteins
  100662583 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like CBP_BcsF
Other DBs
NCBI-GeneID: 100662583
NCBI-ProteinID: XP_003414745
LinkDB
Position
Unknown
AA seq 1254 aa
MKLAAWCRWGLLFALLPPGAAGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPANASLSFLQDIQEVQGYVLVAHNQVRQVPLHRLRIVRGTQLFQDKFALAVLDNR
DPLDHATPATGAVPGGLQELQLRSLTEILKGGVMIQRNPQLCYQETILWKDIFHKNNWLS
LELVDANHSRPCKPCSSACKVPHCWGESSEDCQSLTRTVCASGCARCKGPLPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPPLVVYNTDTFESEINPEGRYTFGASCVVTCP
YNYLSTDVGSCTLVCPLNNQEVTAEDGTQKCEKCSKPCARVCYGLGREHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFEGDPASSTAPLQPEQLRVFETLEEITGYLYISAWPDNLP
DLSVFQNLRVIRGRVLHDGAYSLALQGLGIGWLGLRSLRELSSGLALIHRNARLCFIHTV
PWDQLFRNPHQALLHSANRPDDECEGKDLACYRLCAHGHCWGPGPTQCVNCSQYLRGQEC
VEECRVLQGLPREYVKDRHCLPCHPECQPQNGSETCFGLEADQCVACAHYKDAPFCVARC
PSGVKPDLSFMPIWKFPDEEGTCQPCPINCTHSCADLDEKGCPAEQRASHVTIITTVVGI
LLFMVVGLVLGIVIKRWRQKIRKYTMRRLLQETELVEPLTPSGALPNQAQMRILKETELR
KVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPY
VSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEDVRL
VHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTH
QSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMI
DSECRPRFRELVAEFSRMARDPQRFVVIQNEDMGPSSPLDSTFYRSLLEDDDMGDLVDAE
EYLVPQQGFFCPDPAPGTGGTAHRRHRSSSTRSGGGELTLGLEPSEEEPPRSPLAPSEGA
GSDVFDGDLAMGAAKGLQSLSPHDPSPLQRYSEDPTVSLSPETDGYVAPLTCSPQPEYVN
QPEVRPQPPSPLEVPLPPSCPAGATLERPKTLSPRKNGVVKDVFAFGSAVENPEYLAPRG
GAAPLPHPPPAFSPAFDNLYYWDQDPSERGSPPSTFEETPTAENPEYLGLDMPV
NT seq 3765 nt   +upstreamnt  +downstreamnt
atgaaactggcggcctggtgccgctgggggctcctcttcgccctcctgccccccggagct
gcgggcacccaagtgtgcactggcacagacatgaagctgcggctcccggccagccccgag
acccacctggacatgcttcgccacctctaccagggctgtcaggtggtgcagggtaacctg
gagctcacctacctgcctgccaatgccagcctctccttcctgcaggatatccaggaggtg
cagggctacgtgctcgtcgcccacaaccaagtgaggcaggtccctctgcacaggctgcga
attgtgcgaggcacccagctcttccaggacaaatttgctctggccgtgctggacaacaga
gacccattggaccatgccactcctgccacaggcgctgtccctggagggttgcaggagctg
cagctgcgaagcctcacagagatcctgaagggaggtgtcatgatccagcgaaacccccag
ctttgctaccaggagacgattttatggaaagacatcttccacaagaacaactggctgtcc
ctggagctggtagatgccaaccactcacggccctgcaaaccctgttcttcagcgtgtaaa
gtcccccactgctggggagaaagttctgaggactgtcagagcttgacccgcactgtctgt
gccagtggctgtgcccgctgcaagggcccgctgcccactgactgctgccacgagcagtgt
gctgccggctgcacaggccccaagcactctgactgcctggcctgcctccacttcaaccac
agcggcatctgcgaactgcactgcccacccctggtcgtctacaacacggacacctttgag
tccgaaatcaaccctgagggccgttacacctttggtgccagctgtgtggtcacctgtccc
tacaactacctgtctacggatgtgggctcctgcaccctggtctgtcccctgaacaaccaa
gaggtgacagctgaggatgggacccagaagtgtgagaaatgcagcaagccctgtgcccga
gtgtgctatggcctgggcagggaacacttgcgggaggtgagggcggtcaccagtgccaat
atccaggagtttgccggctgcaagaagatctttgggagcctggcatttctgcccgagagc
tttgagggggacccagcctccagcactgcccccctacagccggagcagctcagagtgttt
gagactctggaggagatcacaggttacctgtacatctcagcgtggccagacaacctgcct
gacctcagtgtcttccagaacctgcgagtcatccggggacgagtcctgcacgacggcgcc
tactcgctggcccttcaaggcctgggtatcggctggctgggacttcgctcactacgggaa
ctgagcagcgggctggccctcatccaccgcaatgcccgtctctgcttcatacacacggtg
ccctgggaccagctcttccggaatcctcaccaggccctgctgcacagtgccaaccggcca
gatgatgagtgcgagggcaaggacctggcctgctaccggctgtgtgcccacgggcactgc
tggggtcctgggcccacccagtgcgttaactgcagccagtacctgcggggccaggagtgt
gtggaggaatgccgagtactgcaggggctcccccgggagtatgtgaaggacagacactgt
ctgccatgccaccctgagtgccagccccagaatggttccgagacctgcttcggattggag
gctgatcagtgtgtggcctgtgctcactataaggacgctcccttctgtgtggctcgttgt
cccagcggtgtgaaacctgacctctccttcatgcccatctggaagttcccagatgaggag
ggcacatgccagccatgccccattaactgcacccactcctgtgcggacctggatgagaag
ggctgccccgctgagcagagagccagccacgtgaccatcatcaccactgtggtgggaatc
ctgctgttcatggtcgtggggctggtcctgggcatcgtaatcaagcggtggcggcagaag
atccggaagtacacgatgcggaggctgctgcaggaaacggagctggtggagccgctgacg
cccagcggagcgctgcccaaccaggctcagatgcggattctaaaagagacggagctgagg
aaggtgaaagtgcttggatctggagcttttggcacagtctacaagggaatctggatccct
gatggggagaatgtgaaaatcccagtggccatcaaagtgttgagggaaaacacatctcct
aaagccaacaaagagatcttggacgaggcatacgtgatggctggtgtgggctccccatat
gtgtctcgcctcctgggcatctgtctgacatccacagtgcagctggtgacacagctcatg
ccctatggctgcctcctagaccatgtccgtgaacaccgtggacgcctgggctcccaggac
ctgctgaactggtgtgtgcagattgccaaggggatgagctacctggaggatgtgcggctt
gtgcacagggacctggctgcccggaacgtgctggttaagagccccaaccatgtgaagatt
acagacttcgggctggcgcggctgctggacatcgatgagactgagtaccatgcagatggg
ggcaaggtgcctatcaagtggatggcgttagagtccattctccgcagacggttcacccac
cagagtgacgtgtggagctacggtgtgactgtgtgggagctgatgacttttggggccaaa
ccttatgatgggatcccagcgcgggagatccctgacctgctggagaagggtgaacggcta
ccccagcctcccatctgcaccattgatgtctacatgatcatggtcaaatgttggatgatt
gactctgagtgtcgtccacggttccgggagttggtggccgaattctcccgcatggccagg
gacccccagcgctttgtagttatccagaatgaggacatgggcccatccagccccttggac
agcaccttctaccgctcgctgctggaggatgatgacatgggggacctggtggatgctgag
gagtacctggtgccccagcagggtttcttctgcccagaccctgccccaggcactgggggc
acagcccaccgcaggcaccgcagttcctccaccaggagtggcggtggtgagctgaccctg
gggctggagccctccgaggaggagccccccaggtcaccactggcaccctcagaaggggct
ggctccgatgtgtttgacggtgacctggcaatgggggcagccaaggggctgcagagcctc
tccccgcatgaccccagccctctacaacggtacagcgaggaccccacagtatctctctca
cctgaaactgatggctacgttgcccccctcacctgcagcccccagcccgaatacgtgaat
cagccagaggttcggccacagcccccctcgcccctagaggtccctctgcctccttcctgc
cctgctggggccactctggaaaggcccaagacactctcccctagaaagaatggggttgtc
aaagacgtttttgcctttgggagtgcagtggagaaccctgagtacttggcaccccgagga
ggggctgcccctctgccccatcctccccctgccttcagcccagcctttgacaacctctat
tactgggaccaggacccatctgagcggggctctccacccagcacctttgaagagacccct
acagcagagaaccctgagtacctgggcctggacatgccagtgtga

DBGET integrated database retrieval system