KEGG   Loxodonta africana (African savanna elephant): 100662586
Entry
100662586         CDS       T04351                                 

Gene name
FASLG
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01524  Platinum drug resistance
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04060  Cytokine-cytokine receptor interaction
lav04068  FoxO signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04210  Apoptosis
lav04217  Necroptosis
lav04650  Natural killer cell mediated cytotoxicity
lav04722  Neurotrophin signaling pathway
lav04932  Non-alcoholic fatty liver disease
lav04940  Type I diabetes mellitus
lav05022  Pathways of neurodegeneration - multiple diseases
lav05142  Chagas disease
lav05143  African trypanosomiasis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05168  Herpes simplex virus 1 infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05320  Autoimmune thyroid disease
lav05330  Allograft rejection
lav05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100662586 (FASLG)
   04014 Ras signaling pathway
    100662586 (FASLG)
   04068 FoxO signaling pathway
    100662586 (FASLG)
   04151 PI3K-Akt signaling pathway
    100662586 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100662586 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100662586 (FASLG)
   04217 Necroptosis
    100662586 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100662586 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100662586 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100662586 (FASLG)
   05205 Proteoglycans in cancer
    100662586 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100662586 (FASLG)
   05330 Allograft rejection
    100662586 (FASLG)
   05332 Graft-versus-host disease
    100662586 (FASLG)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    100662586 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100662586 (FASLG)
   04932 Non-alcoholic fatty liver disease
    100662586 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100662586 (FASLG)
   05161 Hepatitis B
    100662586 (FASLG)
   05160 Hepatitis C
    100662586 (FASLG)
   05164 Influenza A
    100662586 (FASLG)
   05162 Measles
    100662586 (FASLG)
   05168 Herpes simplex virus 1 infection
    100662586 (FASLG)
   05163 Human cytomegalovirus infection
    100662586 (FASLG)
   05165 Human papillomavirus infection
    100662586 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100662586 (FASLG)
   05143 African trypanosomiasis
    100662586 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100662586 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100662586 (FASLG)
   04052 Cytokines and growth factors [BR:lav04052]
    100662586 (FASLG)
   04090 CD molecules [BR:lav04090]
    100662586 (FASLG)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100662586 (FASLG)
Cytokines and growth factors [BR:lav04052]
 Cytokines
  Tumor necrosis fators
   100662586 (FASLG)
CD molecules [BR:lav04090]
 Proteins
  100662586 (FASLG)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 100662586
NCBI-ProteinID: XP_003415273
UniProt: G3TAL3
LinkDB
Position
Unknown
AA seq 277 aa
MWQPLNYPYPQIYWVDSSSSSPLAPPGSALPCPSSVPGRPGQMRPPPPPPPPLPPRPPLP
PFPPSLLKKRRNPNTGLYLLVMFFMVLVALVGLGLGLFQLFHLQKELAELRESTRLSPVA
SSLEKQIGQPSLPSEKREVKKVAHLTGNPNSRSIPLEWEDTYGIALVSGVKYKKGGLVIN
DTGLYFVYSKVYFRGHSCNNQPLNHKVYMRNSKYPQDLVLMEERMMNYCTTGQMWARSSY
LGAVFNLTIADNLYVNVSELSLVNFEESKTFFGLYKL
NT seq 834 nt   +upstreamnt  +downstreamnt
atgtggcagccactgaattacccatatccccaaatctactgggtggacagcagctccagc
tctcctttggcccctccagggtctgctctcccctgcccttcctctgtgcctggaaggccc
ggccaaatgaggccaccaccacccccaccgccaccgctgccaccacggccaccactgcct
ccattcccaccatcacttctgaagaagagacggaatcccaacacaggcctatatctcctc
gtaatgtttttcatggttctggtggccctggttggactggggctggggttgttccagctc
ttccacctgcagaaggagctggctgaactcagagagtccacccgcctaagccctgtagca
tcatctctggagaagcaaataggtcagcccagtctaccttctgaaaaaagggaggtgaag
aaagtggcccatttaacaggaaatcccaactcaaggtccatccctctggaatgggaagac
acctatggaattgccttggtctctggagtgaagtataagaagggtggccttgtgatcaat
gacactggactgtactttgtgtattctaaagtgtattttcggggccactcctgcaacaac
cagcccctgaaccacaaggtctacatgaggaactctaaatatccccaggatctggtgctg
atggaggaaaggatgatgaactactgcactactggccagatgtgggcacgcagcagctat
ctgggagcagtgttcaatctcacaattgctgataatttatatgtcaatgtatctgagctt
tctctggtcaattttgaggaatctaagacatttttcggcttatataagctctaa

DBGET integrated database retrieval system