KEGG   Loxodonta africana (African savanna elephant): 100662633
Entry
100662633         CDS       T04351                                 

Gene name
FADD
Definition
(RefSeq) FAS-associated death domain protein
  KO
K02373  FAS-associated death domain protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01524  Platinum drug resistance
lav04210  Apoptosis
lav04215  Apoptosis - multiple species
lav04217  Necroptosis
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04668  TNF signaling pathway
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05142  Chagas disease
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100662633 (FADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100662633 (FADD)
   04215 Apoptosis - multiple species
    100662633 (FADD)
   04217 Necroptosis
    100662633 (FADD)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100662633 (FADD)
   04621 NOD-like receptor signaling pathway
    100662633 (FADD)
   04622 RIG-I-like receptor signaling pathway
    100662633 (FADD)
   04657 IL-17 signaling pathway
    100662633 (FADD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100662633 (FADD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100662633 (FADD)
   05022 Pathways of neurodegeneration - multiple diseases
    100662633 (FADD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100662633 (FADD)
   05152 Tuberculosis
    100662633 (FADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100662633 (FADD)
   05161 Hepatitis B
    100662633 (FADD)
   05160 Hepatitis C
    100662633 (FADD)
   05164 Influenza A
    100662633 (FADD)
   05162 Measles
    100662633 (FADD)
   05168 Herpes simplex virus 1 infection
    100662633 (FADD)
   05163 Human cytomegalovirus infection
    100662633 (FADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100662633 (FADD)
   05169 Epstein-Barr virus infection
    100662633 (FADD)
   05165 Human papillomavirus infection
    100662633 (FADD)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100662633 (FADD)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100662633 (FADD)
SSDB
Motif
Pfam: Death tRNA_NucTran2_2 T2SSF
Other DBs
NCBI-GeneID: 100662633
NCBI-ProteinID: XP_023397609
LinkDB
Position
Unknown
AA seq 118 aa
MVAGAKDLRAAFDVICDNVGKDWRRLARQLKISDTKIDAIEERYPRNLTEQVRESLRTWK
TARREDATVSQLVTALRACKLNLVADLLEEEQARTLQNRSGSASPMAWSSAGSAFGAP
NT seq 357 nt   +upstreamnt  +downstreamnt
atggtggcaggggccaaagacctgcgagctgcatttgacgttatctgtgacaacgtgggg
aaggactggagaagactcgctcgccaacttaaaatttcagacaccaagatcgacgctatc
gaagagagatatccccgcaacctgacagagcaggtaagggagtcgctgagaacctggaag
accgccaggagggaggacgcaacggtgtcccagctggtgacggccctcagggcctgtaag
ctgaacctggtggcggacctcttagaggaagagcaggctcggaccctccagaacaggagt
gggtccgcgtccccgatggcctggagctcggctggttctgcctttggggctccctga

DBGET integrated database retrieval system