KEGG   Loxodonta africana (African savanna elephant): 100662653
Entry
100662653         CDS       T04351                                 

Gene name
CFTR
Definition
(RefSeq) cystic fibrosis transmembrane conductance regulator
  KO
K05031  cystic fibrosis transmembrane conductance regulator [EC:5.6.1.6]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav02010  ABC transporters
lav04024  cAMP signaling pathway
lav04152  AMPK signaling pathway
lav04530  Tight junction
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    100662653 (CFTR)
  09132 Signal transduction
   04024 cAMP signaling pathway
    100662653 (CFTR)
   04152 AMPK signaling pathway
    100662653 (CFTR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100662653 (CFTR)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    100662653 (CFTR)
   04972 Pancreatic secretion
    100662653 (CFTR)
   04976 Bile secretion
    100662653 (CFTR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100662653 (CFTR)
Enzymes [BR:lav01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.1  Enzymes altering polypeptide conformation or assembly
    5.6.1.6  channel-conductance-controlling ATPase
     100662653 (CFTR)
Transporters [BR:lav02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC7 subgroup
    100662653 (CFTR)
SSDB
Motif
Pfam: CFTR_R ABC_membrane ABC_tran SMC_N AAA_21 AAA_29 RsgA_GTPase AAA_16 T2SSE DUF87 Zeta_toxin MMR_HSR1 MeaB NTPase_1 AAA_30 Intein_splicing
Other DBs
NCBI-GeneID: 100662653
NCBI-ProteinID: XP_023400429
LinkDB
Position
Unknown
AA seq 1637 aa
MHLANLTRAWWLGSREKGGGRSGEVGGGGSRVGRNLARRTVQEASRGAGSPPAGGCSVLE
CRRLDLESGRDCCAPVGKAGLSGLGPARSAHEGGRPARRTGKGRRRAAREGRRRKGRSGR
VARGGCAGGGESSLNKFGAGPGSACLSTWAMEEGEGAKERGGVWSRGGSGELEANDITAG
QRKRGERPALRRVGRVWPLRATAQSSSSGTLAPRRTMQKSPLERASVISKLFFSWPGPIL
RKGYRQHLKLSDIYQIPSVDSADNLSEKLEREWDRELASKKNPKLINALRRCFFWRFVFY
GILLYLGEVTKAVQPLLLGRIIASYDPDNKVERSIAIYLAIGLCLLFIVRTLLLHPAIFG
LHHMGMQMRIAMFSLIYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFVWIA
PLQVTLLMGLIWDLLQASAFCGLAFLIIVALGQAGLGRMMMKYRDKRAGKINERLVITSE
MIENIQSVKAYCWEEAMEKMIENLRQIELRLTRKAAYVRYFNSAAFFFSGFFVVFLSVLP
YAMLKGIILRKIFTTISFCIVLRMAVTRQFPWAVQTWYDSLGAINKIQDFLQKQEYKTLE
YNLTTTDVVMENVTAFWEEGFGELFEKAKQNNNNREISNGDNSLFFSNFSLLGAPVLKDI
NFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKE
NIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYK
DADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSS
YFYGTFSELQTLRPDFSSELMGYDSFDQFSAERRNSILTETLRRFSLEGDTVSWNETKKQ
SFKQAGEFGEKRKNSILNSINSIRKFSVVQKTPLQMNGIDEDSDEPLERRLSLVPDSEQG
EAILPRSNVINTGPTFQRRRRQSVLNLMTRPSINQGQNIHRRTAASARKMSLAPQANLTE
MDIYSRRLSQDSGLEISEEINEEDLKECFFDDVENMPPVTTWNTYLRYVTVHKSLIFVLI
WCLVVFLAEVAVSLVVLYLLRTSSLQDKGNNTTVNANSSYGVIVTNTSSYYLLYIYVGIA
DSLFALAIFRGLPLVHTLIKVSKTLHHKMLRSILQAPMSTFNTLKAGRILNRFSKDIAIL
DDLLPLTMFDFIQLLLIVIGAVVVVSVLQPYIFLATVPVIAAFIILRAYFLHTSQQLKQL
ESEARSPIFTHLVTSVKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRI
EIIFVIFFIAVTFVSILTTGEGEGTIGIILTLAMNIMNTLQWAVNSSIDVDSLMRSVSRI
FKFIDMPTEESKPAKSVKPPKDGQLSKVMIIENQHVKKDYNWPSGGHMTVKDLTAKYIDG
GNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRLLNTEGEIQIDGVSWDSITLQQW
RKAFGVIPQKVFIFSGTFRKNLDPYEQCSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDG
GYVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPITYQIIRRTLKQAFADCTVILCEH
RVEAMLECQQFLVSLYN
NT seq 4914 nt   +upstreamnt  +downstreamnt
atgcaccttgcaaacttaacacgagcgtggtggctaggatctcgggagaaaggaggagga
aggagcggggaagttggcggcggagggtccagggtcgggcggaacctggcgcgtaggacg
gtccaggaggcttcccgcggggccggttcccctcctgccggtggctgctctgtcctcgag
tgccggagactggacctggagagcggccgtgactgttgcgcacctgtgggtaaggctgga
ctgtcgggactaggacctgcgaggagcgcgcatgagggagggaggccggcacgtagaacc
gggaaagggaggcgcagggcagcgagggagggaaggaggcgaaaaggaaggagcggtcgg
gttgcgcgcggagggtgcgcaggaggtggagaaagcagcttgaacaaatttggagccgga
ccaggcagcgcttgtctttcaacttgggcaatggaggagggggaaggagcaaaggaaagg
ggaggtgtgtggagtaggggtgggtcgggggagttggaagcaaatgacatcacagcaggt
caaagaaaaaggggcgagcgcccggcactgcgaagagtagggcgagtttggccattaaga
gctacagcccagtcatcctcgtcagggaccctggcgccccgcaggaccatgcagaagtcg
cctttggaaagggccagcgtcatctccaaacttttcttcagctggcccggaccaattttg
aggaaaggttacagacagcacctgaaattatcagacatataccaaatcccatctgttgat
tctgctgacaatctctctgaaaaactggaaagagaatgggacagagagctggcttccaag
aaaaatcccaaactcattaatgcccttcggcgatgctttttctggagatttgtgttctat
ggaatcttgttatatttaggggaagtcaccaaggcagtccagccactcttactgggaaga
atcatagcttcctatgatccagataacaaggtggaacgctccattgcgatttacttggcc
ataggcctgtgccttctcttcatcgtgaggacgctcctcctacacccagccatttttggc
ctccatcacatgggaatgcagatgagaatagctatgtttagtttgatttataagaagact
ttaaaactgtccagccgtgttcttgataaaataagtattggacaacttgtcagtctcctt
tccaacaacctgaacaaatttgatgaaggacttgcactggcacattttgtgtggattgct
cctttacaagtgacacttctgatggggctgatctgggacctgctccaggcctctgccttc
tgtggacttgctttcctgataattgtcgcccttggtcaagctgggttaggaagaatgatg
atgaagtacagagataagagagctggaaagatcaatgaaagacttgtgatcacctctgaa
atgattgaaaatatccaatctgtgaaggcatactgctgggaggaagcaatggaaaaaatg
atcgaaaacctaagacaaatagagctgagactgacccggaaggcagcctatgtgagatac
ttcaacagcgcagccttcttcttctcagggttcttcgtggtgtttttatctgtgctgccc
tacgcaatgctcaaaggaatcatccttcgaaaaatattcactaccatctcattctgcatc
gttctgcgcatggctgtcactcggcagttcccctgggctgtgcaaacgtggtatgactcg
ctcggagcaataaacaaaatacaggatttcttacaaaagcaagagtataagacgttggaa
tataacttaacaactacagatgtggtgatggaaaatgtgacagccttctgggaggaggga
tttggggaattatttgagaaagcaaaacaaaataataacaatagagaaatttccaatggt
gataacagcctcttcttcagtaacttctcacttcttggtgctcctgtcctgaaggatatc
aatttcaagatagaaagaggacagttattggcggttgctggatctactggagcaggcaag
acttcacttctaatgatgattatgggagaactggagccctcagagggtaaaattaagcac
agtggaagaatttcattctgttctcagttctcctggatcatgcctggcaccattaaagaa
aacatcatctttggtgtttcctatgatgagtatagatataggagtgtcatcaaagcctgc
cagctagaagaggacatttccaagtttgcagagaaagacaatatagttcttggagagggt
ggaatcacactgagtggagggcaacgagccagaatctcgttagcaagggcagtgtacaaa
gatgctgatttgtacctattagactctccttttggatacctagatgttttaacagaaaaa
gaaatttttgaaagctgtgtctgtaaattgatggcgaacaaaactagaattttggtcact
tctaaaatggaacatttaaagaaagctgacaaaatattaattttacatgaaggtagcagc
tatttttatgggacattttctgaactacaaactctacggccagacttcagctcggagctc
atgggatatgattctttcgatcagtttagtgcagaaagaagaaattcaatcctaacggag
accttacggcgtttctcattagaaggagatactgtctcctggaatgaaacaaaaaagcag
tcttttaaacaagctggagagtttggtgaaaaaaggaagaactctattctcaattcaatc
aactccataagaaaattttcagtagtacaaaagactccactacaaatgaatggtattgat
gaagattctgacgagcctttggagagaaggctgtccctagttccggattctgagcaagga
gaggccatcctacctcgaagtaacgtgatcaacacgggtcccacatttcagagacgaaga
agacagtctgttctcaacctgatgacacgcccctcaattaaccaaggtcaaaacattcac
cgaaggacagcagcatccgcacgaaaaatgtcactggcccctcaggctaacttaactgaa
atggatatatattcaagaagattatctcaagacagtggcttggaaataagtgaagaaatt
aatgaagaagatttaaaggagtgcttttttgacgacgtggagaacatgccaccagtgacc
acatggaacacataccttcgatatgttactgtccacaagagcttaatttttgtgctaatt
tggtgtttagttgtttttctggctgaggtggctgtttctttggttgtgttgtatctactt
aggacatcatctcttcaagacaaagggaataatactactgtgaacgcaaatagcagctac
ggagtgatcgtcactaacaccagctcatattatcttttgtacatttatgtgggaatagct
gacagtttgtttgccctggcaatcttcagaggtttaccactggtgcataccctaatcaaa
gtgtcaaaaactttacaccacaaaatgttacgttctattcttcaagcacctatgtcaacg
ttcaacacattgaaagcaggtaggattcttaatagattctccaaagatatagcaattttg
gatgatcttctgcctcttaccatgtttgacttcatccagttgttattaattgtgattggc
gctgtagtagtcgtctctgttttacaaccctacatcttcctggcaacagtgcccgtgata
gctgcgtttattatactgagagcatacttcctccacacctcacagcagctcaaacaattg
gaatctgaagccaggagtcccattttcactcatcttgttacaagcgtaaaaggactatgg
acgctccgtgcctttggacgccagccttactttgaaactctgttccacaaagctctgaat
ttacacactgccaactggttcttgtacctgtcgacacttcgctggttccaaatgagaata
gaaattatttttgtcatcttcttcattgctgttaccttcgtttccattttaacaacaggt
gaaggagaaggaacaattggcattattctaacattagccatgaatatcatgaacacattg
cagtgggctgtaaactccagcatagatgtggacagtttgatgagatctgtgagccgaatc
tttaagtttatcgacatgccaacagaagaaagtaaacctgccaaatctgtcaaaccaccc
aaggatggccagctgtccaaagttatgattattgagaaccagcacgtgaagaaagattac
aactggccctcagggggtcacatgactgtcaaagacctcacagcaaaatatatagatggt
ggcaatgccatattagagaacatttccttctcaataagtcctggccagagggtgggcctg
ttgggaagaactggatcagggaaaagcactttgttatcagcttttttgaggctgctgaac
actgaaggagaaattcagattgatggtgtgtcctgggattcaataactttgcaacagtgg
aggaaagcctttggagtgatcccgcagaaagtgttcatcttttctggaacatttagaaaa
aacttggatccctatgaacagtgtagtgatcaagaaatatggaaagttgcagatgaggtt
ggactcagatctgtgatagagcagtttcccgggaagcttgattttgtccttgtagacggg
ggttacgtcctaagccatggccacaaacagctgatgtgcctggccagatctgttctcagt
aaggcgaagatcttgctgcttgatgaacccagtgctcatttggatccgataacataccaa
atcattcgaagaaccctaaaacaagcattcgctgattgcacagtaatcctctgtgagcac
agggtagaagcaatgttggaatgtcaacaatttttggtgagtctttataattga

DBGET integrated database retrieval system