KEGG   Loxodonta africana (African savanna elephant): 100662887
Entry
100662887         CDS       T04351                                 

Gene name
STX4
Definition
(RefSeq) syntaxin-4 isoform X2
  KO
K13502  syntaxin 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04130  SNARE interactions in vesicular transport
lav04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    100662887 (STX4)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100662887 (STX4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100662887 (STX4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100662887 (STX4)
Membrane trafficking [BR:lav04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    100662887 (STX4)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100662887 (STX4)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 AAA_13 DUF3671 DUF16 T2SSF Lectin_N NPV_P10 GspL_C GlutR_dimer PCRF Nas2_N ETRAMP Baculo_PEP_C Sigma_reg_N
Other DBs
NCBI-GeneID: 100662887
NCBI-ProteinID: XP_003418912
LinkDB
Position
Unknown
AA seq 298 aa
MRDRTHELRQGDDSSDDEDKERVALMVHPGTAWLGNPDDEFFQQVRTIRQTIVELENKVR
ELEKQQVTILATPLPEDSMKQDLQNLREEIKQLGREIRTQLKAIEPQKEEADDNYNSVNM
RMRKTQHGVLSQQFVELINKCNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSG
QSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHEIFTFLATEVEMQGEMINR
IEKNILSSADYVERGQEHVKIALENQKKARKKKILITICVSITVLILAVIIGIAIAVG
NT seq 897 nt   +upstreamnt  +downstreamnt
atgcgggacaggacccacgagctgaggcagggagatgacagctcggacgatgaagacaag
gagcgggtcgcgcttatggtgcacccgggcacggcctggctggggaacccggacgatgag
ttcttccagcaggtcaggacaattcggcaaactattgtcgagctggagaataaagtccgg
gagttggagaagcagcaggttaccatcctggccacgccccttcccgaggacagcatgaag
caggacctgcagaacctgcgcgaggagatcaaacagctggggagggaaatccgcacacag
ctgaaggcaatagagccccagaaggaggaagctgatgataattataactcagtcaacatg
aggatgagaaaaacccagcatggagtcctgtctcagcaattcgtggagctcatcaacaag
tgcaactcgatgcagtctgaataccgggagaagaacgtggagcggattcgaagacagctg
aagatcaccaatgctgggatggtgtctgacgaggagctggaacagatgctggacagtggg
cagagcgaggtgttcgtgtccaatatactgaaggatacacaggtgacccggcaggcccta
aatgagatttcagcccggcacagcgaaatccagcagcttgaacgcagtatccgtgagctt
cacgagatcttcacttttctggctactgaggtggagatgcagggggagatgatcaaccgg
attgagaagaacatcctgagctcagcggactacgtggaacgtgggcaggagcacgtcaag
atagccctggagaaccagaagaaggcacggaagaagaaaatcttgattaccatctgcgtg
tccattactgtcctcatcctggctgtcatcattggcattgccatagcggttggatag

DBGET integrated database retrieval system