KEGG   Loxodonta africana (African savanna elephant): 100662962
Entry
100662962         CDS       T04351                                 

Definition
(RefSeq) somatotropin
  KO
K05438  growth hormone
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
lav04080  Neuroactive ligand-receptor interaction
lav04151  PI3K-Akt signaling pathway
lav04630  JAK-STAT signaling pathway
lav04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100662962
   04151 PI3K-Akt signaling pathway
    100662962
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100662962
   04060 Cytokine-cytokine receptor interaction
    100662962
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100662962
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100662962
Cytokines and growth factors [BR:lav04052]
 Cytokines
  CSF and other factors
   100662962
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 100662962
NCBI-ProteinID: XP_010592877
LinkDB
Position
Unknown
AA seq 287 aa
MVGLADRMGALTLGFGASGCEHRHLRPDFWPSFKCSPSLGGRGGEQKISWGRGRDGMVPR
LLPSSPPWPLCPSLGSRTSLLLAFTLLCQPWPPEADAFPAMPLSSLFANAVLRAQHLHQL
AADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQ
SWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRPGQVLKQTYDK
FDTNMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
NT seq 864 nt   +upstreamnt  +downstreamnt
atggtgggccttgcggataggatgggggcactaactctggggtttggggcttctggatgt
gagcacaggcatctccgcccagacttttggccaagttttaaatgttctccatccctgggg
ggtagaggaggagaacagaaaatctcctggggaagggggagagatggcatggtacctcgc
ctcttgccctccagccctccctggcccttgtgtccctctctaggctcccggacctccctg
ctcctggccttcaccctgctctgccagccctggcctccggaggcggacgccttccccgcc
atgcccttgtccagcctgtttgccaatgccgtgctccgggcccagcacctgcaccagctt
gccgctgacacctacaaggagtttgagcgcgcctacatccctgagggccagaggtactcc
atccagaatgctcaggctgccttctgcttctcggagaccatcccagcccccacaggcaag
gatgaggcccagcagagatccgacgtggagctgctgcgcttctccctgctgctcatccag
tcgtggctcgggccagtgcagttcctcagcagggtcttcaccaacagcctggtgttcggc
acctcggaccgtgtctacgagaagctgaaggacctggaggaaggcatccaggccctgatg
cgggagctggaagatggcagcccccgccctgggcaggtcctcaagcaaacctacgacaag
tttgacacaaacatgcgcagtgatgatgcactgctcaagaactacgggctactgtcctgc
ttcaagaaggacctgcacaaggcagagacgtacctgcgggtcatgaagtgtcgccgcttt
gtggaaagcagctgtgccttctag

DBGET integrated database retrieval system