KEGG   Loxodonta africana (African savanna elephant): 100662965
Entry
100662965         CDS       T04351                                 

Gene name
LMNA
Definition
(RefSeq) lamin
  KO
K12641  lamin A/C
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04210  Apoptosis
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100662965 (LMNA)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100662965 (LMNA)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100662965 (LMNA)
   05414 Dilated cardiomyopathy
    100662965 (LMNA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100662965 (LMNA)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type V: Nuclear lamins
     100662965 (LMNA)
SSDB
Motif
Pfam: Filament LTD TPR_MLP1_2 ATG16 HAUS-augmin3 TolA_bind_tri Fez1 Crescentin Tht1 CENP-F_leu_zip
Other DBs
NCBI-GeneID: 100662965
NCBI-ProteinID: XP_003415191
UniProt: G3SR87
LinkDB
Position
Unknown
AA seq 664 aa
METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLR
LRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARN
TKKEGDLLAAQARLKDLEALLNSKEAALSTALSEKRTLEDELRDLRGQVAKLEAALGEAK
KQLQDEMLRRVDAENRLQTLKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESR
LADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRID
SLSAQLSQLQKQLAAKESKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ
ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQSGGSITKKRK
LEATESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLT
YRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAM
RKLVRSVTVVDDDEDEDGDDLLHHHHGSHCSGTGDPAEYNLRSRTVLCGTCGQPADKASA
SGSGAQVGGSISSGSSASSVTVTRSYRSVGGSGGGSFGDSLVTRSYLLGNSSPRTQSAQN
CSIM
NT seq 1995 nt   +upstreamnt  +downstreamnt
atggagactccgtcccaacggcgcgccacccgtagtggggcgcaggccagctccaccccg
ctgtcgcccactcgcattacccggctgcaggagaaggaagaccttcaggagctcaatgat
cgcctggcggtatacatcgaccgtgtgcgctcactggagacggagaacgcagggctgcgc
cttcgcatcaccgagtccgaggaggtggtcagccgcgaggtgtccggcatcaaggccgcc
tatgaggccgagcttggagatgcccgcaagaccctcgactcggtggccaaggagcgcgcc
cgcctgcagctggagctgagcaaagtgcgagaggagtttaaggagctcaaagcgcgcaac
accaagaaggagggagacttgctggccgcccaggcccgcctcaaggacctggaagctctg
ctcaactccaaggaggccgcgctgagcaccgccctcagtgagaagcgcacactggaggac
gaactgcgtgacctgcggggacaggtggccaagctcgaggcagccctgggtgaggccaag
aagcaacttcaggatgagatgctgcggcgggtggatgctgagaacaggctgcagaccctg
aaggaggaactggacttccagaaaaacatctacagtgaggagttacgtgagaccaagcgc
cgccatgagacccggctggtggagattgataatgggaagcagcgtgagtttgagagccgg
ctggcggatgccctgcaggagctgcgggcccagcatgaggaccaggtggaacagtacaag
aaggagctggagaagacctattctgccaagctggataatgctaggcagtcagccgagagg
aacagcaacctggtgggggctgcccacgaggagctgcagcagtctcgcatccgcatcgac
agcctctcggcccagctcagccagctccagaagcagctggcagccaaggagtcgaagctg
cgggacctggaggactccctggcccgtgagcgggacaccagccggcggctgctggcggag
aaggagcgggagatggcagaaatgcgggcaaggatgcagcagcagctggacgaataccag
gagctgctggacatcaagctggccctggacatggagatccatgcctaccgcaagctcctg
gaaggcgaggaggagaggctacgcctgtcccccagccccacctcgcagcgtagccgtggc
cgtgcctcctctcactcgtcccagacgcagagtgggggcagcatcactaagaagcgcaag
ctggaggccaccgagagccgcagcagcttctcgcagcatgcacgcaccagcgggcgcgtg
gccgtggaggaggtggacgaggagggcaagttcgtgcggctgcgcaacaagtccaatgag
gaccagtccatgggcaactggcagatcaagcgccaaaatggagatgatcccttgctgacc
taccgcttcccaccaaagttcactctgaaggctgggcaggtggtgacgatctgggctgct
ggagctggggccacccatagcccccctactgatttggtgtggaaggcacagaacacctgg
ggctgcgggaacagcctgcgcacggcactcatcaactccactggggaagaggtggccatg
cgcaagctggtgcgctcagtgactgtggttgatgacgacgaggatgaggatggagatgac
ctgcttcatcaccaccacggctcccactgcagcggcacgggggaccccgctgagtacaac
ctgcgttcgcgcaccgtgctgtgcgggacatgcgggcagcctgccgacaaggcgtcggcc
agcggctcgggagcccaggtgggcggatccatctcctctggctcttctgcctccagtgtc
acagtcactcgcagctaccgcagtgtggggggcagtgggggtggcagcttcggggacagc
ctggtcacccgctcctacctcctgggcaactccagtccccgaactcagagcgcccagaac
tgcagcatcatgtaa

DBGET integrated database retrieval system