KEGG   Loxodonta africana (African savanna elephant): 100663174Help
Entry
100663174         CDS       T04351                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav04146  Peroxisome
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100663174 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100663174 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway - mammal
    100663174 (SOD2)
   04213 Longevity regulating pathway - multiple species
    100663174 (SOD2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    100663174 (SOD2)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100663174 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 100663174
NCBI-ProteinID: XP_010597146
LinkDB All DBs
Position
Unknown
AA seq 176 aa AA seqDB search
MQLHHSKHHAAYVHNLNVTEEKYKEALAKGDVTAQVALQPALKFNGGGHINHSIFWTNLS
PNGGGEPKGELLEAIKRDFGSFAKFKEKLTAVSLSVQGSGWGWLGFNKEWGHLQIAACSN
QDPLQGTTGLIPLLGIDVWEHAYYLQYENVRPDYLKAIWNVINWENVSERYMACKK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgcaccacagcaaacaccacgccgcttacgtgcataacttaaacgtcaccgag
gagaagtataaggaggcgctggcaaagggtgatgtcacagcccaggtagctctccagcct
gcgctgaagttcaatggcggaggtcatatcaatcatagcatcttctggacaaacctgagc
cctaatggcggtggagaacccaaaggggagttgctggaagccatcaaacgtgactttggt
tcttttgcgaagtttaaggagaagttgacagccgtgtctcttagcgttcaaggttcaggc
tggggttggcttggtttcaacaaggagtggggacacttacagattgccgcttgttcaaat
caggatccgttgcaaggaacaacagggcttatcccactgcttgggattgatgtgtgggag
catgcttactaccttcagtatgaaaatgtcagacccgattatctgaaagctatttggaat
gtcatcaactgggagaatgtcagtgaaagatacatggcttgcaaaaagtga

DBGET integrated database retrieval system