KEGG   Loxodonta africana (African savanna elephant): 100663262
Entry
100663262         CDS       T04351                                 

Definition
(RefSeq) 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
  KO
K07436  vitamin D3 24-hydroxylase [EC:1.14.15.16]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00100  Steroid biosynthesis
lav01100  Metabolic pathways
lav04928  Parathyroid hormone synthesis, secretion and action
lav05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    100663262
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100663262
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100663262
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:lav00199]
    100663262
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.16  vitamin D3 24-hydroxylase
     100663262
Cytochrome P450 [BR:lav00199]
 Cytochrome P450, animal type
  CYP24 family
   100663262
SSDB
Motif
Pfam: p450 Spermine_synth
Other DBs
NCBI-GeneID: 100663262
NCBI-ProteinID: XP_003419947
UniProt: G3TI45
LinkDB
Position
Unknown
AA seq 513 aa
MRSPVSKSRPLATFLQQLRSPGQPPRAVTSTACTPPRPREVPLCPLMARGEAQKESALPG
PTNWPLLGSLLEILWKGGLKKQHYTLAEYHKKYGEIFRMKLGSFDSVHLGSPCLLEALYR
TESAYPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSVFQKKLMKPVEIMKLDNKVN
EVLADFMGRLDELCDERGHIEDLYSELNKWSFESICLVLYEKRFGLLQKNVGEEALNFIT
AIKTMMSTFGRMMVTPVELHKSLNTRVWQDHTLAWDTIFKSVKSSINSRLEKYSETRNAD
FLCDIYHHNRLSKKELYAAITELQLAAVETTANSLMWVLYNLSRHPQVQQKLLEEIQRVF
PENQIPRAEDLRNMPYLKACLKESMRLTPTVPFTTRTLDKETVLGEYALPKGTVLMLNTQ
VLGSDEDNFEDSSHFRPERWLQEKKISPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVR
KYDIVATDNEPVEMLHLGILVPSRELPIAFCRR
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgaggtcccccgtcagcaagagccgcccccttgccaccttcctgcagcaattgcgcagc
cctgggcagccccccagagccgtgacatccactgcgtgcactcctcctcggccgcgggag
gtgcccctctgcccgctgatggcacgtggcgaggcgcagaaggagtccgccctgcccggc
cccaccaactggccgctgctgggcagcctgctggagattctctggaaagggggactcaag
aaacagcactacacactggcggagtaccacaagaagtacggcgagattttccgcatgaag
ttgggttccttcgactcggtgcacctggggtcaccgtgtctgctggaggcgctgtaccgc
accgagagcgcgtatccccagcggctggagatcaaaccgtggaaggcctatcgcgactat
cgcaaggagggctacgggctgctgatcttggaaggagaagactggcagagggtccggagt
gtctttcaaaagaaactgatgaaaccagtggaaattatgaagctggacaacaaagtcaat
gaggtcttggctgattttatggggagactggatgaactctgtgatgaacgaggccacatt
gaagacttatacagtgaactgaacaaatggtcatttgagagtatctgccttgtgttatat
gagaagagatttggcctccttcagaagaacgtaggggaagaagctttgaacttcatcacg
gccatcaaaacgatgatgagcacgtttgggaggatgatggtgaccccggtggagctgcac
aagagcctcaacaccagagtctggcaggaccacacgctggcctgggacaccattttcaaa
tcagtcaaatcatctatcaacagccgattagagaagtattccgagacacgaaatgcagat
ttcctttgtgacatctatcaccacaatcggctttcaaagaaagaactgtatgctgccatc
acagagctccagctggctgcagtagaaacgacagcaaacagcttaatgtgggtactctac
aatctgtcccgacatccccaagtgcaacaaaagcttcttgaggaaattcaaagagtattt
cccgagaatcagataccccgggcagaggatttgagaaatatgccatatttaaaagcctgt
ctgaaagaatctatgaggcttaccccaactgtaccatttacaactcggactcttgacaag
gaaactgttctgggtgaatatgctttacccaaaggaacagtgttgatgctaaatacccag
gtgttgggctctgatgaagacaattttgaagattcaagtcactttagacctgagcgttgg
cttcaagagaagaagattagcccttttgcacatcttccatttggcgttgggaaacgaatg
tgcatcggccgccgattagccgagctccagctccacttggcactttgctggattgtccgc
aaatacgacatcgtggccaccgacaatgagcctgtggagatgctgcaccttggcatcctg
gtgcccagccgagagctccccattgccttctgccggcgataa

DBGET integrated database retrieval system