KEGG   Loxodonta africana (African savanna elephant): 100663495
Entry
100663495         CDS       T04351                                 

Gene name
SMAD2
Definition
(RefSeq) mothers against decapentaplegic homolog 2 isoform X1
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04144  Endocytosis
lav04218  Cellular senescence
lav04350  TGF-beta signaling pathway
lav04371  Apelin signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04659  Th17 cell differentiation
lav04926  Relaxin signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05142  Chagas disease
lav05166  Human T-cell leukemia virus 1 infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05210  Colorectal cancer
lav05212  Pancreatic cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100663495 (SMAD2)
   04390 Hippo signaling pathway
    100663495 (SMAD2)
   04371 Apelin signaling pathway
    100663495 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100663495 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    100663495 (SMAD2)
   04218 Cellular senescence
    100663495 (SMAD2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100663495 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100663495 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100663495 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100663495 (SMAD2)
   05205 Proteoglycans in cancer
    100663495 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100663495 (SMAD2)
   05212 Pancreatic cancer
    100663495 (SMAD2)
   05225 Hepatocellular carcinoma
    100663495 (SMAD2)
   05226 Gastric cancer
    100663495 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100663495 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100663495 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100663495 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100663495 (SMAD2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 100663495
NCBI-ProteinID: XP_003406355
UniProt: G3SL58
LinkDB
Position
Unknown
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcactccaccagttgtgaagagactgctgggatggaagaaa
tctgctggtgggtctggaggagcaggcggaggagaacagaacggacaggaagaaaagtgg
tgtgagaaagcagttaaaagtctggtgaagaagttaaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaattgtaatactaaatgtgttactataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtctcttgatggtcgtcttcaggtatctcatcga
aaaggattgccacatgttatatattgccgattatggcgctggccagatcttcacagtcat
catgaactcaaagcaattgaaaactgcgaatatgcttttaatcttaaaaaggatgaagta
tgtgtaaacccttaccactatcagagagttgagacaccagttttgcctccagtattagtg
ccacggcacactgagatcttaacagaactaccgcctctggatgattatactcactccatt
ccagaaaacactaatttcccggcgggaattgagccacagagtaattacatcccagaaaca
ccacctcctggatatatcagtgaagatggagaaacaagtgatcaacagctgaaccaaagt
atggacacaggatctccagcggagctgtctcctaccactctttcccccgttaatcatagc
ttggatttgcagccagttacttactcagaacctgcgttttggtgttcaatagcatattat
gaattaaaccagagggttggagagaccttccatgcctcacagccctcgctcactgtagat
ggctttacagacccatccaattcagaaaggttctgcttaggtttactctccaatgtcaac
cgaaacgctacagtagaaatgacaagaaggcatataggaagaggcgtgcgcttatattac
ataggtggggaagtttttgctgagtgcctaagtgacagtgcaatctttgtgcagagcccc
aattgtaatcagagatacggctggcaccctgcaacagtgtgtaagattccaccaggctgt
aatctcaagatcttcaacaatcaggaatttgctgcccttctggctcagtctgttaatcag
ggttttgaagccgtgtaccagctaactagaatgtgcaccataagaatgagttttgtgaaa
ggatggggagcagaataccgaaggcagacagtaacaagtactccttgctggattgaactt
catctgaatggacctctacagtggttggacaaagtattaactcagatgggatccccttca
gtgcgttgctcaagcatgtcataa

DBGET integrated database retrieval system