KEGG   Loxodonta africana (African savanna elephant): 100663502
Entry
100663502         CDS       T04351                                 

Gene name
GRM3
Definition
(RefSeq) metabotropic glutamate receptor 3 isoform X1
  KO
K04606  metabotropic glutamate receptor 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04072  Phospholipase D signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04724  Glutamatergic synapse
lav05030  Cocaine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100663502 (GRM3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100663502 (GRM3)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100663502 (GRM3)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    100663502 (GRM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100663502 (GRM3)
G protein-coupled receptors [BR:lav04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   100663502 (GRM3)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6
Other DBs
NCBI-GeneID: 100663502
NCBI-ProteinID: XP_003407220
UniProt: G3TU42
LinkDB
Position
Unknown
AA seq 879 aa
MKMLTRLQILTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRI
NEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKV
DEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSD
KSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNIC
IATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAARRANTSFTWVAS
DGWGAQESIVKGSEHVAYGAITLELASQPIRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQ
CSLQNKRNHRRACDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCD
AMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQDVGGKYSY
LKVGHWAETLSLDVDSIHWSRKAIPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYL
ADEFTCMDCGPGQWPTADLSGCFDLPEDYIKWEDAWAIGPVTIACLGFMCTCMVVTVFIK
HNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSSVICALRRLGLGTSFAVCYSALL
TKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVVVSVWLILEAPGTRRHTLP
EKRETVILKCNVKDSSMLISLTYDVLLVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCI
IWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKNVVTHRLH
LNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL
NT seq 2640 nt   +upstreamnt  +downstreamnt
atgaagatgttgacaagactccaaatacttaccttagctttgttttcaaagggattttta
ctttctttaggggaccataactttctgaggagggagattaaaatagaaggtgacctggtt
ttagggggcctatttcctattaatgaaaaaggcactggaactgaagaatgtgggcgaatc
aatgaagaccgagggatccaacgcctggaagccatgttgtttgctattgacgaaatcaac
aaagacgattacttattgccaggagtgaagttgggtgttcacattttggatacatgttca
agggacacctatgccctagagcaatcactggaatttgtcagggcgtctttgactaaagtg
gatgaagctgagtatatgtgtcctgatggatcctatgccattcaagaaaatattccacta
ctcattgcaggggtcattggcggctcttacagcagtgtttccatacaggtggcaaacttg
ctaaggctctttcagattcctcagataagctatgcgtccaccagcgccaaactcagcgac
aagtcacgctacgattactttgccaggacagtgccccccgacttctaccaggccaaagcc
atggccgagatcctgcgcttcttcaactggacctacgtgtccaccgtggcctccgaaggg
gactatggggagactgggatcgaggcttttgagcaggaagctcgcctgcgcaacatctgc
atcgccacagcagaaaaggtcggccgctccaacatccgcaagtcctatgacagtgtgatc
cgcgagctgctgcagaagcccaatgcgcgcgtcgtggtcctcttcatgcgcagcgacgac
tcccgcgagctcatcgctgcagccaggcgtgccaacacctccttcacctgggtggccagc
gatggctggggtgcgcaggagagcatcgtcaagggcagtgagcatgtggcctatggcgcc
atcaccctggagctggcctcgcagcccatccgccagttcgaccgctacttccagagcctc
aacccctacaataaccaccgcaacccctggttccgggacttctgggagcagaagttccag
tgcagcctccagaacaagaggaaccaccggcgcgcctgtgacaagcacctggctattgac
agcagcaactatgagcaagaatccaagatcatgtttgtggtgaatgctgtgtatgccatg
gcccacgccctgcacaaaatgcaacgcaccctctgccccaataccaccaagctctgtgat
gctatgaagatcctggacgggaagaagttgtacaaggattatttgctgaaaatcaacttc
acagctccattcaacccaaataaagatgcagatagcatcgtcaagtttgacactttcgga
gatggaatgggccgatacaacgtgttcaattttcaggatgtgggtggcaagtattcctac
ttgaaggttggtcactgggcagaaaccctatcactagatgtcgactctatccactggtcc
cggaaggcaattcccacctcccagtgcagtgacccctgtgcccccaatgaaatgaagaac
atgcaaccaggggacgtttgctgctggatctgcatcccctgcgagccctacgaatacctg
gctgatgagtttacctgtatggattgcgggcctgggcagtggcccactgcagacctatct
ggctgctttgacctccctgaggactacatcaagtgggaagatgcctgggccattggccca
gtcaccatagcctgcctaggttttatgtgcacgtgcatggttgtgactgtttttatcaag
cacaacaacacacccttggtcaaagcatcaggccgggagctctgctacattttgttgttt
ggggttggcctgtcctattgcatgacattcttcttcattgcgaagccgtcgtcagtcatt
tgcgcattgcgccgactagggctggggacctcctttgctgtctgttactcggccctgctg
accaagacaaactgcattgctcgcatttttgatggagtcaaaaatggcgctcagaggcca
aaatttattagccccagttctcaggttttcatctgcctgggtctgatactagtgcaaatt
gttgtggtgtctgtgtggcttattctggaggctccaggtaccaggagacacacccttcca
gagaaacgggaaacagtcatcttaaaatgcaacgtcaaagattccagcatgttgatttcc
cttacctacgatgtgctcctagtgattttatgcactgtgtatgccttcaaaacgcggaaa
tgccctgaaaatttcaacgaagccaagttcattggttttaccatgtacaccacatgcatc
atctggttggccttcctccctatattttatgtgacatctagtgactacagagtgcagacg
acaaccatgtgcatctctgtcagcttgagtggcttcgtggttctgggctgtttgtttgca
cccaaggtgcacatcatcttgttccaaccccagaagaatgtggtcacacacagactgcac
ctgaacaggttcagtgtcagcggaactgggaccacatattcccagtcctctgcaagcacg
tatgtcccaacggtgtgcaacgggcgggaagtccttgactccaccacctcatctctgtga

DBGET integrated database retrieval system