KEGG   Loxodonta africana (African savanna elephant): 100663523
Entry
100663523         CDS       T04351                                 

Gene name
TNFSF11
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 11
  KO
K05473  tumor necrosis factor ligand superfamily member 11
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
lav04064  NF-kappa B signaling pathway
lav04380  Osteoclast differentiation
lav04917  Prolactin signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav05224  Breast cancer
lav05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100663523 (TNFSF11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100663523 (TNFSF11)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100663523 (TNFSF11)
   04928 Parathyroid hormone synthesis, secretion and action
    100663523 (TNFSF11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100663523 (TNFSF11)
 09160 Human Diseases
  09162 Cancer: specific types
   05224 Breast cancer
    100663523 (TNFSF11)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100663523 (TNFSF11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100663523 (TNFSF11)
   04090 CD molecules [BR:lav04090]
    100663523 (TNFSF11)
Cytokines and growth factors [BR:lav04052]
 Cytokines
  Tumor necrosis fators
   100663523 (TNFSF11)
CD molecules [BR:lav04090]
 Proteins
  100663523 (TNFSF11)
SSDB
Motif
Pfam: TNF DisA
Other DBs
NCBI-GeneID: 100663523
NCBI-ProteinID: XP_003412651
UniProt: G3T755
LinkDB
Position
Unknown
AA seq 319 aa
MRRASRDYTKYLRGSEEMGSGGSGAPHEGPLHVPPPPPASHPPPAASRSMFVALLGLGLG
QVVCSVALFLYFRAQMDPNRISEDDTDCFKRLFKLHENSDLRDTTPESQDTKLLPDSCRR
IKQAFQGAVQKELQHIVGSQHIRAEKAMVEGSWSDLARRGKPDTQPFAHLTINATDIPSG
SHKVSLSSWHHDRGWAKISNMTFRNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQL
MVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEAISIQVSNPSL
LDPDQDATYFGAFKVRDID
NT seq 960 nt   +upstreamnt  +downstreamnt
atgcgccgcgccagccgagactacaccaagtacctgcgcggctccgaggagatgggcagt
ggcggctctggcgccccgcacgagggccccctgcacgtcccgccgccgccgcccgcatca
cacccgccccccgctgcctcccgctccatgttcgtcgccctactcgggctggggttgggc
caggtcgtctgcagcgtcgccctgttcctctacttcagagcgcagatggatcctaataga
atatcagaagacgacaccgactgctttaagagacttttcaaactccatgaaaattcagat
ttgcgagacacaactccggagagtcaagacacaaaattactacctgattcgtgtaggaga
attaaacaggcctttcaaggagctgtgcaaaaggaattacaacatattgttggatcacaa
cacatcagagcagagaaagctatggtggaaggttcatggtcagacctggctaggaggggc
aagcctgacactcagccttttgctcatctcactattaatgccaccgacatcccttcaggt
tctcacaaagtgagtctttcctcttggcaccatgaccgaggttgggcaaagatctccaac
atgactttcagaaacgggaaactaatcgttaaccaagatggcttttactacctgtatgcc
aacatttgctttcgacatcatgaaacgtcaggagacctagccacagagtatcttcagctg
atggtgtacgtcactaaaaccagcatcaaaatcccgagctctcataccctgatgaaagga
ggaagcaccaaatactggtccggaaattcggaattccatttttattccataaatgtcgga
ggattttttaaactacgatctggtgaagcaataagcatccaggtatccaacccttcacta
ctagatccagaccaagatgcaacttactttggggcttttaaagttcgagatatagattga

DBGET integrated database retrieval system