KEGG   Loxodonta africana (African savanna elephant): 100663725
Entry
100663725         CDS       T04351                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53 isoform X1
  KO
K04451  tumor protein p53
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav01524  Platinum drug resistance
lav04010  MAPK signaling pathway
lav04071  Sphingolipid signaling pathway
lav04110  Cell cycle
lav04115  p53 signaling pathway
lav04137  Mitophagy - animal
lav04151  PI3K-Akt signaling pathway
lav04210  Apoptosis
lav04211  Longevity regulating pathway
lav04216  Ferroptosis
lav04218  Cellular senescence
lav04310  Wnt signaling pathway
lav04722  Neurotrophin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav05012  Parkinson disease
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05203  Viral carcinogenesis
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05216  Thyroid cancer
lav05217  Basal cell carcinoma
lav05218  Melanoma
lav05219  Bladder cancer
lav05220  Chronic myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05230  Central carbon metabolism in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100663725 (TP53)
   04310 Wnt signaling pathway
    100663725 (TP53)
   04071 Sphingolipid signaling pathway
    100663725 (TP53)
   04151 PI3K-Akt signaling pathway
    100663725 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100663725 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    100663725 (TP53)
   04210 Apoptosis
    100663725 (TP53)
   04216 Ferroptosis
    100663725 (TP53)
   04115 p53 signaling pathway
    100663725 (TP53)
   04218 Cellular senescence
    100663725 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100663725 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100663725 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    100663725 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100663725 (TP53)
   05202 Transcriptional misregulation in cancer
    100663725 (TP53)
   05206 MicroRNAs in cancer
    100663725 (TP53)
   05205 Proteoglycans in cancer
    100663725 (TP53)
   05203 Viral carcinogenesis
    100663725 (TP53)
   05230 Central carbon metabolism in cancer
    100663725 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100663725 (TP53)
   05212 Pancreatic cancer
    100663725 (TP53)
   05225 Hepatocellular carcinoma
    100663725 (TP53)
   05226 Gastric cancer
    100663725 (TP53)
   05214 Glioma
    100663725 (TP53)
   05216 Thyroid cancer
    100663725 (TP53)
   05220 Chronic myeloid leukemia
    100663725 (TP53)
   05217 Basal cell carcinoma
    100663725 (TP53)
   05218 Melanoma
    100663725 (TP53)
   05219 Bladder cancer
    100663725 (TP53)
   05215 Prostate cancer
    100663725 (TP53)
   05213 Endometrial cancer
    100663725 (TP53)
   05224 Breast cancer
    100663725 (TP53)
   05222 Small cell lung cancer
    100663725 (TP53)
   05223 Non-small cell lung cancer
    100663725 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100663725 (TP53)
   05014 Amyotrophic lateral sclerosis
    100663725 (TP53)
   05016 Huntington disease
    100663725 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100663725 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100663725 (TP53)
   05161 Hepatitis B
    100663725 (TP53)
   05160 Hepatitis C
    100663725 (TP53)
   05162 Measles
    100663725 (TP53)
   05168 Herpes simplex virus 1 infection
    100663725 (TP53)
   05163 Human cytomegalovirus infection
    100663725 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100663725 (TP53)
   05169 Epstein-Barr virus infection
    100663725 (TP53)
   05165 Human papillomavirus infection
    100663725 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100663725 (TP53)
   01522 Endocrine resistance
    100663725 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100663725 (TP53)
   03036 Chromosome and associated proteins [BR:lav03036]
    100663725 (TP53)
   03400 DNA repair and recombination proteins [BR:lav03400]
    100663725 (TP53)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    100663725 (TP53)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100663725 (TP53)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100663725 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD CEP1-DNA_bind
Other DBs
NCBI-GeneID: 100663725
NCBI-ProteinID: XP_003416950
LinkDB
Position
Unknown
AA seq 519 aa
MFSINSTLAALVCRTSPPQNPGSLRSLLFHSLSASPLPTGKLLALTCHGDCPALCQKPRG
GCWDWEFPFPCAHTGAKSFQLFKSPKPPSWLQLAAGLWRYLVSGLGPCFQGRLHARLRFG
GQIALPGAAMEEPQSDLSTELPLSQETFSYLWELLPENPVLSPTLPPAVEVMDDLLLSED
TANWLESQVEAQGMSTTPAPATPTPVAPAPATSWTLSSSVPSQKTYPGTYGFRLGFLHSG
TAKSVTCTYSPDLNKLFCQLAKTCPVQLWVASPPPPGTRVRTMAIYKKSEHMTEVVKRCP
HHERCSDSSDGLAPPQHLIRVEGNLRAEYLEDSITLRHSVVVPYEPPEVGSDCTTIHFNF
MCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRICACPGRDRRTEEENFHKKGEPC
PEPPPPGRSTKRALPTNTSSSTQPKKKPLDEEYFTLQIRGRERFKMFLELNEALELKDAQ
AGKEPEGSRAHSSPSKSKKGQSTSRHKKPMFKREGPDSD
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgttttccatcaattctactcttgcagctctagtttgtagaacttccccaccacaaaat
cctggttctcttcgctccctcctcttccactccttatctgcttcgcccctgcctacaggc
aaattacttgcccttacttgtcatggcgactgtccagctttgtgccagaagcctcgcggt
ggttgctgggattgggagtttcccttcccatgtgctcacactggcgctaaaagttttcag
ctcttcaaaagcccaaagccaccatcctggttgcagctagctgctgggctctggcggtac
ctggtgtccgggctcggaccgtgcttccaaggacggttacacgctcgcctgaggttcggg
ggccagattgccctccctggagctgcaatggaggagccccagtcagatctcagcaccgag
ctccctctgagtcaagagacgttttcatacttatgggaactccttcctgagaatccggtt
ctgtcccccacactacccccggcagtggaggtcatggacgatctgctactctcagaagac
actgcaaactggctagaaagccaagtggaggctcagggaatgtccacaacccctgcacca
gccacccctacaccggtggcccccgcaccagccacctcctggaccctgtcatcttccgtc
ccttcccaaaagacctaccctggcacctatggtttccgtctgggcttcctacattctggg
acagccaagtccgtcacctgcacgtactcccctgaccttaacaagctgttttgccagctg
gcaaaaacctgcccagtgcagctgtgggtcgcctcaccacccccgcccggcacccgtgtt
cgcaccatggccatctacaagaagtcagagcatatgacggaggtcgtcaagcgctgcccc
caccatgagcgctgctctgactctagcgatggcctggcccctcctcagcacctcatccgg
gtggaaggaaacctgcgtgctgagtatctggaggacagcatcactctccgacacagtgtg
gtggtgccctacgagccgcccgaggtcgggtctgactgtaccaccatccacttcaacttc
atgtgtaacagctcctgcatggggggcatgaaccggcggcccatcctcaccatcatcaca
ctggaagactccagtggtaatctgctgggacgtaacagctttgaggtgcgcatttgtgcc
tgtcctggaagagacagacgtacagaagaagaaaatttccacaagaagggagagccttgc
ccagagccgccaccccctgggaggagcactaagcgagcactgcccaccaacaccagctcc
tctacccagccaaagaagaagccactggatgaagaatatttcacccttcagatccgtggg
cgtgaacgcttcaagatgttcctagagctaaatgaggccttggagctgaaggatgcccag
gctgggaaggagccagaggggagccgggctcactccagcccttcgaagtctaagaaggga
cagtctacctcccgccataaaaaaccaatgttcaagagagagggacctgactcagactga

DBGET integrated database retrieval system