KEGG   Loxodonta africana (African savanna elephant): 100663737
Entry
100663737         CDS       T04351                                 

Gene name
RYR3
Definition
(RefSeq) LOW QUALITY PROTEIN: ryanodine receptor 3
  KO
K04963  ryanodine receptor 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04371  Apelin signaling pathway
lav04713  Circadian entrainment
lav04921  Oxytocin signaling pathway
lav04970  Salivary secretion
lav05010  Alzheimer disease
lav05012  Parkinson disease
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100663737 (RYR3)
   04020 Calcium signaling pathway
    100663737 (RYR3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100663737 (RYR3)
  09154 Digestive system
   04970 Salivary secretion
    100663737 (RYR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100663737 (RYR3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100663737 (RYR3)
   05012 Parkinson disease
    100663737 (RYR3)
   05020 Prion disease
    100663737 (RYR3)
   05022 Pathways of neurodegeneration - multiple diseases
    100663737 (RYR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100663737 (RYR3)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Ryanodine receptor
   100663737 (RYR3)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 Ins145_P3_rec MIR SPRY RIH_assoc Ion_trans EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5
Other DBs
NCBI-GeneID: 100663737
NCBI-ProteinID: XP_023414540
LinkDB
Position
Unknown
AA seq 4867 aa
MPRPGLTWGGIVRTTHVCLFSWQEDEVVLQCIASVHKEQRKFCLAAEGLGNRLCFLEPTS
EAKYVPPDLCVCNFVLEQSLSVRALQEMLANTGENGSEGAAQGGGHRTLLYGHAILLRHS
FSGMYLTCLTTSRSQTDKLAFDVGLREHATGEACWWTIHPASKQRSEGEKVRIGDDLILV
SVSSERYLHLSISNGNIQVDASFMQTLWNVHPTCSGSSIEEGYLLGGHVVRLFHGHDECL
TVLSTDQNDSQHRRIFYEAGGAGTRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHY
LALTEDQGLILQDRGKSDTKSTAFSFRASKEIKEKLDSSHKRDIEGMGVPEIKYGDSVCF
VQHIASGLWVTYKAQDSKTSRLGPLKRKVILHQEGHMDDGLTLQRCQREESQAARIIRNT
TALFSQFVSGNNRTAAPVTLPIEEVLQTLQDLIAYFQPPEEEMRHEDKQNKLRSLKNRQN
LFKEEGMLALVLNCIDRLNIYNSVAHFAGIAREESGTAWKEILNLLYKLLAALIRGNRNN
CAQFSNNLDWLISKLDRLESSSGILEVLHCILIESPEALNLIAEGHIKSIISLLDKHGRN
HKVLDVLCSLCLCNGVAVRANQNLICDNLLPRRNLLLQTRLINDVTSIRPNIFLGVAEGS
AQYKKWYFELIIDQVDPFLTAEPTHLRVGWASSSGYAPYPGGGEGWGGNGVGDDLYSYGF
DGLHLWSGRIPRAVASINQHLLRSDDVVSXVALTSGCPASLSASMGSRCRGCXENFNTDG
LFFPVVSFSAGVKVRFLMGGRHGEFKFLPPSGYAPCYEALLPKEKMRLEPVKEYKRDAEG
VRDLLGTTQFLSQASFIPCPIDTSQVVLPPHLEKIRDRLAENIHELWGMNKIELGWTFGK
TRDDNKRQHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHANPAAEEDLKKVKL
PKNYMMSNGYKPAPLDLSDVKLSPPQEILVDKLAENAHNVWAKDRLKQGWTYGIQQDLKN
KRNPRLVPYALLDERTKKSNRDSLREAVRTFVGYGYNIEPSDQELADPTVEKVSIDKIRF
FRVERSYAVRSGKWYFEFEVVTGGDMRVGWARPGCRPDIELGADDQAFVFEGSRGQRWHQ
GSGYFGRTWQPGDVVGCMINLDDASMIFTLNGELLITNKGSELAFADYEVENGFVPICSL
GLSQIGRMNLGTDASTFKYYTMCGLQEGFEPFAVNMNRDVAMWFSKRLPTFVNVPKDHPH
IEVMRIDGTMDSPPCLKVSHKTFGTQNSSAGMIYCRLSMPVECHSSFSHIPCLDSDAFQK
RKQMQEIFSHPTTQCYYAIRIFAGQDPTCVWVGWVTPDYHLYSEKFDLNKNCTVTVTLGD
ERGRVHESVKRSNCYMVWGGDIVASSQRSSRSNVDLEIGCLVDLAMGMLSFSANGKELGT
CYQVEPNTKVFPAVFLQPTSTSLFQFELGKLKNAMPLSAAIFKSEEKNPVPQCPPRLDVQ
TIQPVLWSRMPSNFLKVEMERVSERHGWVVQCLEPLQMMALYIPEENRCVDILELCEQED
LMQFHYHTLRLYSAVCALGNNRVAYALCSHVDLSQLFYAIDNKYLPGLLRSGFYDLLISI
HLANAKERKLMMKNEYIIPITSTTRKVSLYPDESKRHGLPGVGLRTCLKPGFRFSTPCFV
VTSEEHHKQSPEIPLEILKTKALSMLTEAVQCSGAHIRDPVGGSVEFQFVPVLKLIGSLL
VMGVFNDEDVQQILLLIDPSVFGEHSGETEEGGEKEEVTQVEEKAVEAGEKASKEAQAPV
KGLLQTRIPESVKLQMCELLSYLCDCELQHRVEAIVAFGDIYVSKLQANQKFRYNELMQA
LNMSAALTARKTKEFRSPPQEQINMLVNFQLGENCPCPEEIREELYDFHEDLLLHCGVPL
EEEEEEEDNTSWTGKLWSLVYKIKGLPKPEKQQPTEEEEGAPTTLKELISQTMICWAQED
QVQDAELVRMMFTLLRRQYDSIGELLQALRKTYTISHASVSDTINLLAALGQIRSLLSVR
MGKEEELLMIHGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLGTEKSQIAFPKMVA
SCCRFLCYFCRISRQNQKAMFEHLSYLLENSSFGLASPSMRGSTPLDVAASSVMDNNELA
LSLEEPDLEKVVTYLAGCGLQSCPMLLAKGYPDIGWNPIEGERYLSFLRFAVFVNSESVE
ENASVVVKLLIRRPECFGPALRGEGGNGLLAAMQGAIKISENPALDLPSQGYKREVSMED
DGEGEEIVHMGNAIMSFYSALIDLLGRCAPEMHLIQTGKGEAIRIRSILRSLVPTEDLVG
IISIPLKLPSVNKDGSVMEPDMAANFCPDHKAPMVLFMDRVYGIKDQPFLLHLLEVGFLP
DLRASASLDTVSLSTTEAALALNRYICSAVLPLLTRCAPLFAGTEHCTSLIDSTLQTIYR
LSKGRSLTKAQRDTIEECLLAICNHLRPSMLQQLLRRLVFDVPLLNEYCKMPLKLLTNHY
EQCWKYYCLPSGWGSYGLAVEEELHLTEKLFWGIFDSLSHKKYDPDLFRMALPCLSAIAG
ALPPDYLDTRITATLEKQVSVDAEGNFDPKPINTMNFSLPEKLEYVVTKYAEHSHDKWAC
DKSQNGWKYGISLDENVKTHPLIRPFRTLTEKEKEIYRWPARESLKTMLAVGWTVERTKE
GEALVQQRENEKLRSMSQASQGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHNIWAKKK
KLELESKGGGSHPLLVPYDTLTAKEKFRDREKAQDLFKFLQVNGIIVSRGMKDMELDASS
MEKRFAHKFLKKILKYVDSAQEFIAHLEAIVSSGKTEKSPHDQEIKFFAKVLLPLVDQYF
TNHRLYFLSSPLKPLSSSGYASHKEKEMVASLFCKLAALVRHRISLFGSDSTTMVSCLHI
LAQTLDTRTVMKSGSELVKAGLRAFFENAAEDLEKTSENLKLGKFTHSRTQIKGVSQNIN
YTTVALLPILTSIFEHVAQHQFGMDLLLGDVQISCYHTLCSLYSLGTGKNIYVERQRPAL
GECLASLAATIPVAFLEPTLNRNNPLSVFNTKTPRERSILGMPDTVEEMCPDIPHLEGLM
KEINDLAESGARYTEMPHVIEVILPMLCNYLSYWWERGPENLPPSAGPCCTQVTSEHLSV
ILGNILKIINNNLGIDEASWMKRIAVYAQPIISKARPDLLRSHFIPTLEKLKKKAVKIVQ
EEEQLKADSRGDTQEAELLILDEFAVLCRDLYAFYPMLIRYVDNNRSNWLKSPGADSDQL
FRMVAEVFILWCKSHNFKREEQNFVIQNEINNLAFLTGDSKSKMSKSGGQDQERKKTKRR
GDFYSIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKSRYSYRDTDEEVKEHLRNNLHL
QEKSDDPAVKWQLNLYKDVLKSEEPSNPEKTVERVQRISAAVFHLEQVEQPLRSKKAVWH
KLLSKQRKRAVVACFRMAPLYNLPRHRSINLFLHGYQRFWIETEEYSFEEKLVQDLAKSP
KAEEEEEEEMEKPPDPLHQIILHFSRNALTERSKLEDDPLYTSYSSMMAKSCQNGEDEEE
EDKEKTFEEKEMEKQKTLYQQARLHERGAAEMVLQMISASKGEMSPMVVETLKLGIAILN
GGNTSVQQKMLDYLKEKKDAGFFQSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGTRE
KVLQNDEFTRDLFRFLQLLCEGHNSDFQNFLRTQMGNTTTVNIIISTVDYLLRLQESISD
FYWYYSGKDIIDESGQHNFSKALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGF
LHVFANMQMKLSQDSSQIELLKELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLVESS
TNVEMILKFFDMFLKLKDLTSSETFKEYDPDGKGIISKKEFQKAMEGQKQYTQSEIDFLL
SCAEADENDMFNYIDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAESVLN
YFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKME
LFVNFCEDTIFEMQLASQISESDSADRPEEVEEEEDSLYTLEMEGDEEEDTSFETASAFA
MACASVKRNIANFLKRATLKNLKKQYRKVKKMTAKELVKVFFSFFWMLFVGLFQLFFTIL
GGVFQILWNTVFGGGLVEGAKNIRVTKILGDMPDPTQFGIHDDVIEAERAEVIEPGITTE
LVHFIKGEKGDADIMSDLFGLHPKKEGSLKHGPDGGLGDLSEIIGKDGPPTLESTVQKKR
KAQAAERKVVREAEGKVDSEKADMEDGEKEERAKEEEQAEYLWAEVTKKKKRRRGQKVEK
PEAFMANFFKRLEIYQTKLLHYLARNFYNLRFLALFVAFAINFILLFYKVTEEPLEEETE
DVANLWNSFNDEEEEEAMVFFVLQESTGYMAPTLRALAIIHTIISLVCVVGYYCLKVPLV
VFKREKEIARKLEFDGLYITEQPSEDDIKGQWDRLVINTPSFPSNYWDKFVKRKVINKYG
DLYGAERIAELLGLDKNALDFSPVEEAKTEEASLVSWLSSVDMKYHIWKLGVVFTDNSFL
YLAWYTTMSFLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYL
YTVVAFNFFRKFYNKSEDDDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPYE
MYRIVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDYFDT
TPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRK
QYEDQLG
NT seq 14604 nt   +upstreamnt  +downstreamnt
atgccacggcctggtttaacctgggggggaatagtccgtaccactcacgtgtgtctcttc
tcctggcaggaagatgaagtggtactccagtgcattgcgagcgttcacaaggagcaaagg
aagttctgcctggcagctgagggacttgggaatcgcctgtgcttcttggagccaacgtca
gaagccaagtatgttcctccagatctctgcgtctgcaattttgtgctggaacagtccctc
tctgtccgagccctgcaggaaatgcttgccaacacaggtgaaaacggcagtgaaggggca
gcacaaggaggtggtcacaggaccctgctgtatggccacgcgattctcctgcggcactct
ttcagcggaatgtatctaacatgtttgactacatcaagatcccagacagataagcttgcc
tttgatgttggtctacgggaacatgccacaggagaagcctgttggtggaccatacatcct
gcttccaaacagagatctgagggagagaaagttcgaattggcgatgacctcatcctcgtc
agtgtgtcctctgaaagataccttcatctctcaatatcaaatggtaacatacaagtggat
gcctcctttatgcaaacactctggaatgtacatcctacgtgctcaggaagtagcatcgaa
gaaggatacctgcttggtgggcacgtagtacgccttttccatggtcacgatgagtgtttg
acagtactatctacggaccagaatgactcccagcacaggcggatattctatgaagctggg
ggagcaggaacgcgagccaggtctctgtggagagtggaaccccttcggataagctggagt
ggcagtaacatcagatggggccaagctttccgactccggcatctcaccacaggccactac
ctggccttgacagaggaccaaggcctcatactgcaagaccggggaaagtcagacacaaag
tccacagccttctctttccgggcatcaaaggaaatcaaggagaaattggattccagccac
aaacgagatatagaaggcatgggggttccagaaattaagtatggagattccgtctgcttt
gtccagcatattgccagtggtttgtgggtgacctacaaagcacaggactccaaaacgtca
cgccttggacctctgaaaagaaaggtcatactccatcaggaaggccacatggatgatgga
ctaacactgcagagatgtcagcgtgaggagtcccaggctgctcggatcatccggaacaca
acagccttattcagtcagtttgtcagtggaaacaaccgcacagctgcccctgtcaccctg
cccatagaagaagtcctccagaccctacaggacttgatcgcctacttccagcccccggaa
gaggagatgcggcatgaagacaaacaaaacaagctccgctcactcaagaacagacagaat
cttttcaaggaagagggaatgttggccctagtgttaaattgcatcgatcgcttaaatatc
tacaatagcgtagcacacttcgcagggattgcaagggaagagagtggcacagcttggaaa
gaaattctgaacctactgtataaactgctggctgctctcattcgtggaaacagaaacaac
tgtgctcaattctccaacaaccttgattggctaatcagtaaattggacagactagaatct
tcctcaggtatcttggaagttttgcactgcatcttgattgagagcccagaagccttaaat
ctgatagcagagggccacatcaaatccatcatttcactgttggataagcatgggaggaat
cacaaggttctggatgtgctgtgttccctctgtctctgcaatggggtcgcagtgagagcc
aaccagaatctgatctgtgacaacctgctgccccggagaaacctgctcctacagacacga
ctgattaatgatgtgaccagtatccggccaaacatcttcttgggagtcgctgagggctca
gcccagtacaagaaatggtacttcgagctaattatcgaccaggtggatcccttcctaaca
gcagagcccacacatctccgggtgggctgggcctcgtcctcaggctacgccccataccct
ggaggtggagaaggatggggaggcaatggtgttggcgatgacctgtactcctatggcttt
gatggacttcacctttggtcaggccggatccctagagccgtggcctccatcaaccagcac
ctcctgaggtccgatgacgtggtgagcnntgttgccttgacctcggggtgcccagcatct
ctttccgcatcaatgggcagccggtgcaggggatgtnttgagaacttcaacacagatgga
ctcttcttccctgtggtgagcttttcagctggtgtcaaagtacgtttcctgatgggtgga
cgtcatggagagtttaagttcctgcctccctctggctatgccccttgctacgaagcttta
ctgccaaaagagaagatgcgactggagcctgtcaaagaatataagcgcgatgccgaaggt
gttagagatctgttgggtaccactcagttcctctcccaggcttctttcatcccatgtccc
atagacaccagtcaggttgttttgccacctcacctggagaaaatccgagacagactggct
gaaaatatccatgagctttggggaatgaataaaatagagcttgggtggactttcggcaag
acgcgggatgacaataaaagacaacacccctgccttgtggagttttcaaagctacctgaa
acagagaagaattataacctgcaaatgtcaactgaaaccctaaaaaccctcctggccctg
ggatgccacatcgctcatgctaatccagctgctgaggaagatctcaagaaagtgaaactg
cccaaaaactacatgatgtccaatggctataaaccagcccctttggatttgtctgacgtg
aagctgtcacctccgcaagaaattttagtggataagcttgcagagaatgctcataacgtt
tgggcaaaagacagactaaaacaaggatggacctacggcattcaacaggatttgaagaac
aaaagaaatccccgtctggtgccatatgcgttactggacgagcgtaccaagaagtcaaac
agggacagcctccgtgaagctgttcgaacgtttgttggttatgggtataacattgagcca
tcagaccaagaactagctgacccaacggtggagaaagtcagcatagacaagatccggttt
ttccgggtagagcggtcttacgcagtgcgatctggaaagtggtactttgaatttgaggtg
gtgactggaggagacatgcgggtcggctgggccagaccaggctgccggcctgacattgaa
ctgggggccgatgaccaagcctttgtatttgaaggcagcaggggccagcgttggcatcaa
gggagtggctattttggacgtacctggcagccaggagatgtggttggatgtatgattaac
ctggatgatgcttcaatgatcttcacactgaatggggagctgctgatcacaaacaaaggc
tctgaacttgccttcgcggactacgaggttgagaatggctttgtgcccatctgttctctg
gggctgtctcagattggccgcatgaaccttgggacagatgccagcaccttcaagtattac
accatgtgcggcctccaagagggctttgagccttttgctgtcaacatgaaccgagatgtt
gcgatgtggttcagcaagcgcctcccaacatttgtcaacgtgccaaaggatcatccacac
atagaggtcatgaggattgacggcaccatggacagcccaccatgcctcaaggtgtcccac
aagacgttcggcacacagaacagcagcgccggcatgatctactgccgcctgagcatgccc
gtggagtgccactcctccttcagccacatcccctgcctggacagtgatgctttccagaaa
aggaaacagatgcaagaaatattctctcatccaacaacacagtgctactatgcgatccgc
atctttgctggacaggaccccacctgcgtctgggtcggatgggtgaccccggactatcac
ttgtacagtgaaaagtttgacctgaataaaaactgcacagtgaccgtgaccctgggggat
gagaggggccgggtccatgaaagtgtgaaacgcagcaactgctacatggtctggggtggg
gacatagtggccagttcccaaagatcgagtcgcagtaacgtggacctggaaattggctgc
ctcgtggatctggcgatgggcatgttgtccttctcagccaatgggaaagaacttggcacc
tgctaccaggtggagcccaataccaaagtgtttccagcagtgttcctacagcccacaagc
acttctttgtttcagtttgagcttggaaagctgaagaatgcaatgcccctgtcggctgcc
atatttaaaagtgaagagaagaacccagtcccgcagtgtccacctcggctggacgtccag
accatccagcctgtgctctggagccgcatgcccagcaacttcctgaaggtggagatggag
cgggtgagcgagcgccatggctgggtggtacagtgcctggagcctctgcagatgatggcg
ctctacatcccagaggagaacaggtgtgtggatatcctggagctttgtgagcaggaggac
ttgatgcagttccattaccacactctgaggctctacagtgctgtgtgtgccctgggaaac
aaccgagtagcctacgctctgtgcagccatgtagacctctcccagctcttctacgccatt
gacaacaagtacctccctggcctccttcgatccgggttctatgacctactcatcagcatc
cacctggccaacgctaaggagaggaagctgatgatgaagaatgaatatatcatccccatt
accagtaccaccaggaaagttagcttgtacccagatgaatccaagaggcatggactgccc
ggagtgggcctgaggacatgcctcaagccagggttcaggttctctaccccttgctttgtt
gtgaccagtgaggagcaccacaagcagagccctgagattcccttggagattctcaagaca
aaagcattgagcatgctgacagaggccgtgcagtgcagcggggcacacatccgtgacccc
gttgggggctctgtggaattccagtttgtgcctgtgctgaagctcattggatccctgctg
gtcatgggggtgtttaatgatgaagatgttcagcagatcctcctgctgatcgatccctct
gtgtttggggagcacagtggggagacagaggagggaggagaaaaggaggaagtgactcag
gtggaggagaaggcagtggaagctggggaaaaggccagcaaggaagcccaggctccagtc
aaaggcttgttgcagacccggatacctgagtccgtcaaactgcagatgtgtgagctcctc
agctatctctgtgactgtgagctgcagcaccgagtggaggccatcgtggcattcggcgac
atttatgtctccaagctgcaggcaaaccagaagttccgctacaatgagctcatgcaggcc
ctgaacatgtctgcagccctgaccgcccgaaagaccaaggagttccgctcacccccacag
gagcagatcaatatgcttgttaactttcaactgggagagaattgtccttgcccagaagag
atccgggaggagctgtatgacttccatgaggatcttctccttcactgtggagttcccctg
gaggaagaggaagaggaggaggacaacacctcctggactggaaaactctggtcattggtg
tataaaatcaaaggcctacccaagccggagaaacagcagccaactgaggaggaggaggga
gcccctacaacattgaaagagctcatctcacagacaatgatatgctgggcccaggaggac
caggtccaggatgcagagctggtccggatgatgtttaccctcctgcgaaggcagtacgac
agcatcggagagctgctgcaggccctgaggaagacctataccatcagccatgcctccgtc
agtgacaccatcaatctgctggctgccctgggccagatccgctccctcctcagcgtcagg
atgggcaaggaagaagagctgctcatgatccatggactgggagacataatgaacaacaaa
gtgttctaccagcatcccaacctcatgagagtccttggtatgcacgagacggtgatggag
gtgatggtgaacgtgttgggtacagagaaatctcagattgcttttcccaagatggtcgct
agctgttgccgcttcctttgctacttctgtcgaattagccggcaaaatcagaaagccatg
tttgagcatctgagctatctgctggaaaatagcagttttggcctagcctccccgtcgatg
aggggatccaccccactagatgtggcagcttcctccgtcatggacaacaacgagttagcg
ctgagcttagaggaaccagacctcgaaaaggtggtgacctacttggcaggctgtggccta
caaagctgccccatgcttctggcaaaaggataccctgacatcggctggaaccccattgaa
ggggagcgctacctgtccttcctgaggtttgctgtcttcgtgaacagtgaaagtgtggaa
gaaaacgctagcgttgttgtcaagctgctcatcagacgcccagagtgctttggtccagcc
ctgcggggtgaaggaggaaatggtctgttggctgccatgcagggtgccattaagatctct
gagaacccagcactcgacctcccctctcagggatacaagagagaagtcagcatggaggac
gacggagagggagaagaaatcgtgcacatgggcaatgcaattatgtcattttattcagct
cttatagatctgctgggccgctgtgctcccgaaatgcaccttatccagacaggaaaaggg
gaagccatccgaatcaggtcgatcctacgctctctcgtccccacagaagacttggttggg
atcattagcatccccttgaagctgccctcagtgaacaaagatggttcagtcatggagcca
gacatggcggccaacttctgtcccgaccacaaggcacccatggtgctgttcatggatcgc
gtctatggtattaaggaccaaccttttctgctccacttgctagaggttggatttttacct
gacttaagagcctctgcctctctagacacggtgtccctaagcaccacggaggctgcgctt
gcattaaataggtatatatgctctgcggttctcccactcctcacaagatgtgcccctcta
ttcgccgggacggaacactgtacatctttgattgattctacactgcaaacaatatacagg
ctttccaagggacgttccctcaccaaagcacagagggataccatagaagagtgtttgctt
gccatttgcaatcacttgaggccttccatgttacaacagcttctgcgacgtcttgttttt
gatgtgccactccttaacgaatactgcaaaatgcccctcaagcttctgacgaatcactat
gaacagtgctggaagtattattgcctgccttcagggtgggggagctacggtcttgccgtg
gaggaagaactgcacctaacagagaagcttttctgggggatttttgattccctctcccat
aagaagtatgacccagatcttttccgaatggctctgccttgtctcagcgctatagccggg
gccttgccaccagattacttagataccagaatcacagccacgttggagaaacaggtttca
gtggacgcagaggggaattttgacccaaaacctatcaacaccatgaatttttccttgcct
gaaaagttggaatacgttgtcaccaagtatgctgagcattcacatgataaatgggcctgt
gacaagagtcagaatggatggaaatatggtatttccttggatgaaaatgtgaagacccac
ccactgataaggcctttcaggacattaacggagaaggagaaggaaatttatcgctggcct
gccagagagtccctaaaaaccatgctggctgtgggctggactgtggagaggaccaaagag
ggagaagccttggttcaacagcgggaaaatgagaagcttcgaagtatgtcccaggccagc
cagggcaatagctacagccctgcacccctcgacctctcaaacgttgtcctctccagagaa
ctccagggaatggtggaggtcgtggctgagaactatcacaatatctgggccaagaagaag
aaactggagctggagagcaaaggtggcggcagtcaccctcttttggtaccatatgacact
ttgaccgccaaggagaagttcagggaccgagagaaggcacaggacctgtttaaattcctc
caagtgaatggcattatagtttctaggggtatgaaggatatggagctggatgcctcatcc
atggaaaagaggtttgcccataaatttttgaagaagatcctgaaatatgttgattctgct
caagagtttattgcccatttggaagccattgtcagcagtgggaaaactgaaaagtctcct
catgatcaggagatcaaattctttgccaaagttctcctcccgctggttgaccagtacttc
accaatcatcgcctctatttcctgtcatcccctctaaagccccttagcagcagtgggtat
gcatctcataaggagaaagaaatggtggccagcctattctgcaaacttgctgctctagtt
agacataggatttccctctttgggagcgattctactaccatggtgagctgtcttcacatc
ttagctcagacacttgacacaaggacagtcatgaagtcaggctcagagctggtgaaggcg
gggttacgtgcattctttgaaaatgctgccgaagacttagagaagacttcagaaaacctg
aaacttggcaagtttacccattccagaacgcagattaaaggcgtctctcagaatattaac
tatacaacggtggctctgctacccatcctgacgtccatctttgagcacgtcgctcagcat
cagtttgggatggatttgctcttgggcgatgtgcagatttcatgctaccatactctgtgc
agcctctactcacttgggacaggaaagaacatctatgttgaaaggcaacgtcctgccctt
ggagaatgtctggcctcactggcagcgaccataccagtggcattcctggagcccaccctt
aaccgcaacaatccactctctgtcttcaacaccaaaacccccagagagaggtctattctg
gggatgccagacactgtagaagagatgtgccccgacatcccccacctggaaggcctgatg
aaggaaatcaacgacctggctgagtcaggggcccggtacaccgagatgccacatgtcatc
gaagtgatcttgcccatgctctgcaactacctgtcctactggtgggagcggggccctgag
aacctgccccccagcgcagggccctgctgcacccaggtcacctccgaacatctcagtgtc
atcctgggcaacattctgaaaatcatcaacaacaacctgggcatcgacgaggcctcctgg
atgaagcgcattgcagtgtatgcccagccgataatcagcaaagccaggcctgacctgctg
agaagccactttatcccaactctggagaagctgaagaaaaaggctgtcaagatagtgcag
gaggaggagcagctgaaggcagacagcagaggggacacccaggaggcagagctcctgatc
ctggatgagtttgcagtcctctgcagagacctctatgccttctaccccatgctgattcgc
tacgtggacaacaacagatctaactggctcaaaagccccggtgctgattctgaccagctc
ttccgcatggtggcagaggtcttcatcctgtggtgcaaatctcacaacttcaaaagggaa
gagcaaaattttgtgattcagaatgaaattaataatttggcatttttaactggagacagc
aaaagcaagatgtcaaaatctggaggacaggaccaagaacggaagaagacaaagcggagg
ggagacttctattctatccagacctccctcatcgtggctgcactcaagaaaatgctgccc
attggtttgaatatgtgcaccccaggtgaccaggagctgatctcccttgcaaaatcacga
tacagctacagggacacagatgaagaggtcaaggaacacctacggaataacttgcacttg
caggaaaagtctgatgacccagctgtaaaatggcaactgaatctctacaaggatgttctg
aagagtgaagaaccttccaatccagaaaagacagtggagcgcgtgcagagaatttcagca
gctgtctttcacctggagcaggtggaacagcccttgaggtccaagaaagcagtctggcac
aaactgttgtcaaagcaacggaaacgggcagtggtggcctgtttcaggatggctcctctc
tacaacttgcccaggcaccgctctattaacctcttcctccatggctatcagagattttgg
atagaaacagaggagtattcctttgaagagaaactagtacaggatttggctaaatctccc
aaggcggaagaggaggaggaggaagagatggaaaagccaccagacccacttcatcagatc
attctccactttagtcgcaacgcactcactgagaggagcaaattggaagatgatcctttg
tacacctcctattccagcatgatggccaagagttgtcagaatggggaagatgaagaagag
gaagacaaggaaaaaacatttgaagagaaagagatggagaagcagaaaacgctttatcag
caagcccggctgcatgagcggggtgctgctgagatggtcctccagatgataagtgccagc
aaaggtgagatgagccctatggtggttgagactctgaagctgggcatcgccattctgaat
ggaggcaacactagtgtacaacagaaaatgctagattacctaaaagagaaaaaggatgct
ggattctttcaaagcctttctggtcttatgcagtcttgcagtgtccttgacttgaatgca
tttgaaaggcagaataaagctgaaggcctggggatggttactgaagaaggaacacgtgaa
aaagtgctccagaatgatgagtttacacgcgatctctttagattcctacaattactctgt
gaaggacataacagtgacttccagaacttcctgcggactcagatgggcaacactaccacc
gtgaacatcatcatcagtacggtggactaccttctgcgtctgcaggaatcaatcagtgat
ttctactggtattattcagggaaggacatcattgatgaatctggacagcacaacttttcc
aaagctctggcagtcaccaagcagattttcaattccctcacagaatacatccagggacct
tgcattgggaaccagcagagcctggctcacagtaggctatgggacgcagtggtcggcttc
ctccatgtatttgctaacatgcagatgaaactctctcaggattccagtcagatcgagctg
ctgaaggaactcttggatctccttcaggacatggtggtgatgcttctgtccctcctggaa
gggaatgtggtaaatggaactattggcaagcagatggttgacacactggtagagtcatct
accaatgtcgaaatgatcttgaaattctttgacatgttcttgaaacttaaagacttaacc
agctcagaaaccttcaaagaatatgacccagatggtaaagggattatctccaaaaaagaa
ttccagaaggccatggaagggcaaaaacagtacacacagtcagagattgactttctcctt
tcatgtgcagaagctgatgagaatgacatgtttaattacattgattttgtagaccggttt
catgagccagccaaggacatagggtttaatgtggcagtgttactgacaaatctttccgaa
cacatgccaaatgattctcgtctgaagtgtctgttggacccagcagaaagtgtgctgaat
tacttcgagccatacctaggacgcattgagatcatgggtggggccaagaagattgaacgt
gtttattttgaaatcagcgaatccagtcgaactcaatgggagaagccccaagtgaaggaa
tctaagcgacagttcatctttgatgttgtcaatgaaggtggggagcaagaaaagatggag
ttgttcgtgaacttctgtgaggatacaatctttgaaatgcagttagcatctcagatctct
gaatctgattcagctgacaggccagaagaggtggaagaagaagaagattctttgtataca
ttagaaatggagggtgacgaggaagaagatacgtcttttgagacggcctctgcatttgcc
atggcgtgtgcctcagtgaagagaaacatcgccaattttctgaagagggcaaccctgaaa
aatctcaagaagcagtatcggaaggtgaaaaagatgactgcgaaggagctggtgaaggtg
tttttctcctttttctggatgttgtttgtagggctattccagttgttcttcactatctta
ggaggagtctttcagatcctctggaatacagtgtttggaggcggcctggtagaaggggcg
aagaacatcagagtcaccaagatcctgggtgacatgcctgacccaactcagtttggaatt
catgatgatgttatagaggctgagagggcagaagtgattgagccgggtatcactactgaa
ctagtacacttcataaagggtgagaagggagatgcggacattatgtcagatctctttgga
ctccatccaaagaaagaaggcagcttaaaacatgggcctgacgggggtttgggtgacctc
tctgagattattggcaaggatggaccccctacgttagagagtactgtacagaagaaaagg
aaagcacaggcagcagaaaggaaagtagtacgtgaagcagaaggaaaagtagactctgag
aaggcagacatggaagatggggagaaggaggagagagccaaagaagaggaacaagcagag
tacctttgggcagaagtgacaaaaaagaagaagcgacggcgtggccagaaagttgagaag
cctgaagccttcatggccaacttctttaaaaggctggaaatctatcagaccaagttattg
cattacctggccaggaatttctacaacctgaggttccttgctctgtttgtagccttcgct
atcaacttcatcctgctcttttacaaggtcaccgaagaacctttagaagaagagacagaa
gatgttgcaaacctgtggaattccttcaatgatgaggaagaggaagaagccatggtgttc
tttgtcctgcaagagagcactgggtatatggcaccaacgttgcgggccctggccatcatc
catactatcatctccttggtctgtgtggtgggctactattgcctgaaggtccctttggtg
gtattcaaaagagaaaaagaaattgctaggaagctggagtttgatggcctgtatatcact
gaacagccatcggaagatgacattaagggtcaatgggatcgcttggtaatcaacacacca
tcttttcctagtaactattgggacaagtttgtaaaaagaaaggtgatcaacaagtatgga
gatctctatggagcagaacgcattgctgaactcctgggtttggataaaaacgcccttgac
tttagcccagtagaagaggcaaaaaccgaggaagcttctctggtgtcatggctaagttct
gtcgacatgaagtaccatatttggaagctgggcgttgtttttactgacaattcctttctc
taccttgcctggtatacaaccatgtcattcctgggccactacaacaacttcttctttgct
gctcatctgctggatatcgcaatgggtttcaagacactgcggaccattctgtcatctgta
actcacaatggcaaacagttggttctgactgtgggtctcctggctgtggtggtttatctc
tataccgtggtggctttcaacttcttccgcaagttctacaacaaaagtgaagatgacgac
gagcccgatatgaagtgtgatgacatgatgacgtgttaccttttccacatgtacgtggga
gtgagagcagggggtggcattggcgatgaaattgaagaccctgctggtgacccttatgaa
atgtaccgcatagtctttgacattaccttcttcttctttgtcattgtcatcttgctggcc
atcattcaaggtcttattattgatgcctttggagagctaagagaccagcaggaacaagtg
cgagaagatatggagactaaatgcttcatctgtgggattggcaacgattactttgacact
acccctcatggttttgaaacacatacattacaagagcacaacctagccaactacttgttc
tttctgatgtatttgattaacaaagatgaaacagaacacaccggtcaggaatcttatgtc
tggaagatgtaccaagaaaggtgttgggacttcttcccagctggtgactgctttcgtaaa
caatatgaagaccaacttggctaa

DBGET integrated database retrieval system