KEGG   Loxodonta africana (African savanna elephant): 100663763
Entry
100663763         CDS       T04351                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04390  Hippo signaling pathway
lav04810  Regulation of actin cytoskeleton
lav05200  Pathways in cancer
lav05218  Melanoma
lav05224  Breast cancer
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100663763 (FGF1)
   04014 Ras signaling pathway
    100663763 (FGF1)
   04015 Rap1 signaling pathway
    100663763 (FGF1)
   04390 Hippo signaling pathway
    100663763 (FGF1)
   04151 PI3K-Akt signaling pathway
    100663763 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100663763 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100663763 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100663763 (FGF1)
   05218 Melanoma
    100663763 (FGF1)
   05224 Breast cancer
    100663763 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100663763 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100663763 (FGF1)
Cytokines and growth factors [BR:lav04052]
 Growth factors
  Growth factors (RTK binding)
   100663763 (FGF1)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100663763 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100663763
NCBI-ProteinID: XP_003404621
UniProt: G3SWB4
LinkDB
Position
Unknown
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKGTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccgaaggggaaatcacaactttcacagccctgacagagaagttcaacctgcctcca
gggaattacaagaagcccaaactcctctactgtagcaatggaggtcacttcttaaggatc
cttccagatggcacagtggatggcaccagggacaggagtgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagggcaccgagactggccagtacttg
gccatggacaccgacgggcttttatacggctcacagacaccaaatgaggaatgtttgttc
ctggaaaggctggaggaaaaccattacaacacctacacatccaagaagcacgcagagaag
aattggttcgttggtctcaagaagaatggaagctgcaaacgcggtcctcggactcactat
ggccagaaagcaatcttgtttctccccctgccagtctcctctgattaa

DBGET integrated database retrieval system