KEGG   Loxodonta africana (African savanna elephant): 100663865Help
Entry
100663865         CDS       T04351                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03030  DNA replication
lav03410  Base excision repair
lav03420  Nucleotide excision repair
lav03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100663865 (LIG1)
   03410 Base excision repair
    100663865 (LIG1)
   03420 Nucleotide excision repair
    100663865 (LIG1)
   03430 Mismatch repair
    100663865 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lav03032]
    100663865 (LIG1)
   03400 DNA repair and recombination proteins [BR:lav03400]
    100663865 (LIG1)
Enzymes [BR:lav01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100663865 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     100663865 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100663865 (LIG1)
DNA replication proteins [BR:lav03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100663865 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100663865 (LIG1)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100663865 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     100663865 (LIG1)
   MMR (mismatch exicision repair)
    Other MMR factors
     100663865 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2 DDR
Motif
Other DBs
NCBI-GeneID: 100663865
NCBI-ProteinID: XP_003406544
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MQRSIMSFFQPKKEGKAKKPEKETSNSSRETEPPPKVALKERNGVVPESESPVKRLVRKA
ARVLSSEEEEEDSALTSLKGQKPAPGSPKASPPSPAASLESIPSPSEASPVEVSPSGIPK
RRTARKQLPKRKIQDVLEEQSGDKERETKRKKEEEEAETPAESVTEPEVAKKKEAEDEDQ
PRMSPKPCKTSEAETPAESTSEPAVGVKKEPQEGDQTKPSPRPSKRISSFFTPRKPATKK
EVKEEGSGAPGEEETKGPLDPADYNPAKNNYHPIEDACWKSGQKVPYLAVARTFEKVEEV
SARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNRLGPPQQGLELGVGDGVLLKAVAQAT
GRQLESVRAEAAEKGDVGLVAESSRTTQRIMLPPPPLTASGVFAKFRDIARLAGSASTAK
KIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALAQAVSLTPPGQEFPPAVVD
AGKGRTAEARKMWLDEQGMVLKQTFCEVPDLDCIVPVLLEHGLEHLPEHCRLSPGIPLKP
MLAHPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTGKYPDII
DRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKDVDASEIQVQVCLYAFDL
IYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDTDQIAEFLEQSVRDSCEGL
MVKTLDVDATYEIAKRSHNWLKLKKDYLEGVGDTLDLVVIGAYLGRGKRAGRYGGFLLAT
YDKESEELQAICKLGTGFSDEELEKHHQSLQALVLPSPRSYVRADGAVAPDHWLEPSTVW
EVKCADLSLSPIYPAARGLVDREKGISLRFPRFIRIRDDKKPEEATTSAQVAQLYQAQSQ
IQNQKGASSESDLEDFY
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatcatgtcatttttccaacccaagaaggagggcaaagcaaagaagcca
gagaaagaaacctccaacagcagcagagagacggaacctcccccaaaagtggcgctgaag
gagcggaatggagtggtgcccgagagtgagtctccagtgaagagactggtgaggaaggca
gcccgggtcttgagcagtgaagaggaggaggaggacagtgctctcacctctctcaaaggc
cagaaacctgctccaggctctccgaaagcctcccctcccagtcctgctgcatctctggag
agcatcccttccccctccgaagccagtcccgtggaagtctccccatcagggattccgaag
cgtcgcacagctcggaagcagctcccgaaacggaaaattcaggatgtcctggaagaacag
agtggagacaaggaaagagagaccaagaggaagaaggaagaagaagaagcagagacccca
gcagaaagtgtcacagagcctgaagtggcaaaaaaaaaggaagcagaagatgaggaccag
cccaggatgtcacctaaaccctgcaagacttctgaagcagagaccccagcagaaagcact
tcagagcctgcagtgggcgtgaaaaaggagccacaggagggggaccagaccaagccttcc
cccaggccttctaagaggatcagcagtttcttcacccctcgaaagccagccacaaaaaaa
gaagtgaaagaagaggggtcaggtgctccaggagaagaggagacaaagggacccctggac
ccagccgactacaatcctgccaagaacaactaccaccctattgaagatgcctgctggaag
tctggccagaaggtcccctatctggctgtggcccggacctttgagaaggttgaggaggtc
tctgctcggctccggatggtggagacactgagcaacctgctgcgctccgtggtggccctg
tcacctccagacctcctccctgtcctctaccttagtctcaaccgccttgggccaccacag
cagggcctggagcttggcgtcggtgacggcgtccttctcaaggccgtggcccaggccaca
ggtcggcagctggagtccgtccgggccgaggcagccgagaagggtgacgtggggctcgta
gccgagagcagccgcaccactcagaggatcatgttgccccctcccccacttaccgcctct
ggggtcttcgccaagttccgtgacatcgcccgactggctggtagtgcttccacagccaag
aagatagacatcatcaaaggcctctttgttgcttgccgtcactcagaagcccgattcatc
gcccggtccctgagtggacggctgcgcctcgggctggctgagcagtcagtcctggctgcc
ctcgcccaggccgtgagcctcacaccccccggccaagaattccccccggctgtggtggat
gctgggaagggcaggacagcggaggccaggaagatgtggttggatgaacaaggcatggtc
ctgaagcagacgttctgtgaggtgcccgacctggactgcatcgtgccagtcctgctggag
cacggcttggagcatctaccagagcactgcaggctgagcccagggatccccctgaaacca
atgctggcccatcccacccggggtgtcagcgaagtcctaaagcgctttgaggaggcagct
ttcacctgcgaatacaaatacgatgggcagagggcacagatccatgttctggaaggcggg
gaggtgaagatcttcagccggaatcaggaggacaataccgggaagtaccctgatatcatc
gaccgcatccccaagatcaaactcccatcagtcacctccttcatcctggacactgaggcc
gtggcttgggaccgggaaaagaagcaaatccagccattccaagtgctcaccacccgcaaa
cgcaaggacgtggatgcatcagagatccaggtgcaggtgtgtttgtacgccttcgacctc
atctacctcaatggagagtcactggtacgggagcccctctcacgacgccggcagctgctc
cgggagaactttgtggagacagagggtgagtttgtcttcgccacctcgctggacaccaag
gacacagaccagatcgccgagttcttggagcagtcggtgagagactcgtgcgaggggctg
atggtgaaaaccctggatgtggatgctacctacgagatagccaagaggtcgcacaactgg
ctcaagctgaagaaggactacctcgagggagtgggcgacaccctggacctcgtggtgatc
ggtgcctacctgggccgggggaagcgtgctggccgctacgggggcttcctcctggccacc
tacgacaaggagagtgaggagcttcaagccatatgcaagcttggaacgggcttcagcgac
gaggagctggagaaacatcaccagagcctccaggccctggtgctgcccagccctcgctcc
tacgtgcgggccgatggggccgtggccccagaccactggctggagcccagcaccgtgtgg
gaggtgaagtgtgctgacctgtccctctcccccatctaccctgcggcccgtggtctggtg
gaccgtgagaagggcatttcccttcgcttccctcggtttattcgcattcgtgatgacaag
aagccagaggaagccaccaccagtgcccaggtggcccagctgtaccaggcgcagagtcag
atccagaaccagaaaggtgcgagctcggagtccgaccttgaggatttctactaa

DBGET integrated database retrieval system