KEGG   Loxodonta africana (African savanna elephant): 100663989
Entry
100663989         CDS       T04351                                 

Gene name
ATP4B
Definition
(RefSeq) potassium-transporting ATPase subunit beta
  KO
K01543  H+/K+-exchanging ATPase subunit beta [EC:7.2.2.19]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00190  Oxidative phosphorylation
lav01100  Metabolic pathways
lav04966  Collecting duct acid secretion
lav04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100663989 (ATP4B)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    100663989 (ATP4B)
  09155 Excretory system
   04966 Collecting duct acid secretion
    100663989 (ATP4B)
Enzymes [BR:lav01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.19  H+/K+-exchanging ATPase
     100663989 (ATP4B)
SSDB
Motif
Pfam: Na_K-ATPase Iron_traffic
Other DBs
NCBI-GeneID: 100663989
NCBI-ProteinID: XP_003413675
LinkDB
Position
Unknown
AA seq 290 aa
MAALQEKKTCSQRMEEFRHYCWNPDTGQMLGRTLSRWVWISLYYVGFYVVMTGLFALCIY
TLMRTIDPYTPDYQDQLKSPGVTLRPDVYGEKGLQIFYNVSDNKTWTDLTNMLHKFLAAY
SPAAQKANINCPLERYYFQESFDAPNHTKYSCKFPVDTLQNCSGLIDPNFGFEEGKPCFI
IKMNRIVNFLPSNSTAPRVDCTFPEDHNDTPPLEVEYYPPNGTFSLHYFPYYGKKAQPQY
RNPLVAAKFLNIPKNTEVVIVCKIIAEYVTFDNPHDPYEGKVEFKLKIQK
NT seq 873 nt   +upstreamnt  +downstreamnt
atggcagctttacaagaaaaaaagacttgcagccagaggatggaagaattccggcactac
tgctggaacccggacaccgggcagatgctaggacggactctatctaggtgggtgtggatt
agcctctattacgtgggtttctacgtggtgatgacagggctctttgcgctgtgcatttac
acgttgatgcggaccatcgacccgtacacaccagactaccaggatcaattaaaatcacca
ggggtaaccttaaggccagatgtttatggagagaaaggtctgcaaattttctacaatgtt
tctgataataaaacctggacagacctaacaaatatgcttcacaagttcctggcagcctat
tctccagcagctcagaaggccaatataaactgccctttggagaggtactatttccaggaa
agtttcgacgctcctaaccacaccaagtactcctgcaagttcccggtagatacactgcaa
aactgctccggcctgatagatcctaactttggatttgaagaaggaaagccctgttttatt
attaaaatgaacaggattgtcaacttcctccccagcaacagcactgctcccagagtggac
tgcacgttcccggaggaccacaacgacaccccacccctggaggttgagtactacccaccc
aacggcaccttcagcctacactacttcccttactatgggaaaaaagctcagccccaatat
agaaaccctctggttgcagcaaaatttctcaacatccccaagaacacagaagttgtcatc
gtgtgcaaaatcatcgcagaatacgttaccttcgacaatccccatgacccgtatgaagga
aaagtggaattcaaacttaaaattcagaagtaa

KEGG   Loxodonta africana (African savanna elephant): 100670470
Entry
100670470         CDS       T04351                                 

Gene name
ATP4A
Definition
(RefSeq) potassium-transporting ATPase alpha chain 1
  KO
K01542  H+/K+-exchanging ATPase subunit alpha [EC:7.2.2.19]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00190  Oxidative phosphorylation
lav01100  Metabolic pathways
lav04966  Collecting duct acid secretion
lav04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100670470 (ATP4A)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    100670470 (ATP4A)
  09155 Excretory system
   04966 Collecting duct acid secretion
    100670470 (ATP4A)
Enzymes [BR:lav01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.19  H+/K+-exchanging ATPase
     100670470 (ATP4A)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C CD225 Cation_ATPase_N Hydrolase Hydrolase_3
Other DBs
NCBI-GeneID: 100670470
NCBI-ProteinID: XP_023395589
LinkDB
Position
Unknown
AA seq 892 aa
MAQSDSDETPPTRPFAEYMTLSLVALFCCLPFGIAAIIYTCKTKKANKRGDEHKAERYSN
LAFSLGLTAVILGLWIYINMKKEMEINDHQLSVAELEQKYQTSATKGLSASLAAELLLRD
GPNALRPPRGTPEYVKFARQLAGGLQCLMWVAAAICLIAFAIQASEGDLTTDDNLYLALA
LIAVVMVTGCFGYYQEFKSTNIIASFKNLVPQQATVIRDGDKCQINADQLVVGDLVEMKG
GDRVPADIRILAAQGCKVDNSSLTGESEPQTRSPECTHESPLETRNIAFFSTMCLEGTAQ
GLVVNTGDRTIIGRIASLASGVENEKTPIAIEIEHFVDIIAGLAILFGATFFVVAMCIGY
TFLRAMVFFMAIVVAYVPEGLLATVTVRWGAEEGGRELRGLSICLAIHPSSTHPSPYFFL
LGFCQLYLSEKDYPPGYAFDVEDMNFPTSSLCFAGLVSMIDPPRATVPDAVLKCRTAGIR
VIMVTGDHPITAKAIASSVGIISEGSETVEDIAARLRVPVDQVNHKDARACVISGMQLKD
MDPSELVEALRTHPEMVFARTSPQQKLVIVESCQRLGAIVAVTGDGVNDSPALKKADIGV
AMGIAGSDAAKNAADMILLDDNFASIVTGVEQGRLIFDNLKKSIAYTLTKNIPELTPYLI
YITVSVPLPLGCITILFIELCTDIFPSVSLAYEKAESDIMHLRPRNPKRDRLVNEPLAAY
SYFQIGAIQSFAGFTDYFTAMAQEGWFPLLCVGLRPQWEDHHLQDLQDSYGQEWTFGQRL
YQQYTCYTVFFISIEVCQIADVLIRKTRRLSAFQQGFFRNRILVIAIVFQVCIGCFLCYC
PGMPNIFNFMPIRYQWWLVPLPYGILIFVYDELRKLGVRCCPGSWWDQELYY
NT seq 2679 nt   +upstreamnt  +downstreamnt
atggcgcagagtgactctgatgagactcccccgacccgtccctttgcggagtacatgact
ctgtccctcgtggctctcttctgctgcctgcccttcggaattgcagccattatttacacc
tgcaaaaccaagaaagccaacaaacgtggagatgagcacaaggcagagagatattccaac
ctggccttttccttgggccttacagctgtcatcctgggcctgtggatctacattaacatg
aagaaggagatggagattaatgaccaccagctgtcagtggcagaactggagcagaagtac
cagaccagtgcgaccaagggcctgtctgccagcctggcagctgagctgctgctgagggat
gggcccaatgcactcaggccgccgcggggaaccccagagtacgtcaagtttgcgcgacaa
ctggcaggcggcctgcaatgcctcatgtgggtggctgctgccatctgcctcattgccttc
gccattcaggccagcgagggcgacctaaccactgatgacaatctatacttggcactggcc
ctcattgctgtagtcatggtcactggctgctttggctactatcaggagtttaagagcacc
aacatcattgccagcttcaagaaccttgtaccccagcaagcaaccgtgatccgtgacggg
gacaaatgccagatcaacgcggaccagcttgtggtgggagatctggtggagatgaagggc
ggggaccgagtgccagccgacatccgcatccttgcagcccagggctgcaaggtggacaac
tcctcgctgactggggagtcggagccgcagacccgctcacctgagtgcacacacgagagc
cccctggagacccgcaacatcgccttcttctctactatgtgccttgagggcacagcgcag
ggcctggtggtgaacacaggcgaccgcaccattatcgggcgcattgcatccctggcatca
ggagtggaaaatgaaaagacgcccattgctattgagattgaacactttgtggacatcatc
gcaggcttggccatcctctttggtgccacattttttgtggtggccatgtgcattggttac
accttcctgcgtgccatggtcttcttcatggccattgtggtagcctatgtgcctgagggg
ctgttggccactgtcacggtgagatggggggcagaagaggggggcagggagttgagaggc
ctgtccatctgtttggccattcatccaagctccacccatccatctccctattttttcctg
ctaggcttctgccagctctacctgagtgagaaggactacccacctggctatgcctttgac
gtggaggacatgaactttccaaccagcagcctgtgctttgcgggacttgtatccatgata
gacccaccccgagccactgtgccagacgctgtgctcaagtgccgcactgcaggcatccgg
gtgatcatggtgacaggtgaccaccccatcacagccaaggccatcgcatctagcgtgggg
atcatctcagaaggcagtgagacggtggaagacatcgctgcccgcctccgagtgcctgtg
gaccaggttaatcacaaggatgcccgcgcctgtgtgatcagcggcatgcagctgaaggac
atggacccgtcagagctggttgaggcgctgcgcacccaccctgagatggtgtttgcccgc
accagtccccagcagaagctggtgattgtggagagctgccagcgactgggtgcaatcgtg
gctgtgacaggggatggcgtgaacgactccccggccctgaagaaggcagacatcggtgtg
gccatgggcatcgctggctcagatgctgccaaaaatgcggccgacatgatcctcctggat
gacaacttcgcctccattgtgacgggcgtggagcagggccgcctgatctttgacaacctg
aagaagtccatcgcttacacgctgaccaagaacatccctgagctgacgccctacctcatc
tacatcaccgtcagcgtgcccctgcccctcggctgcatcaccatcctcttcatagagctc
tgcaccgacatcttcccgtcggtatctctggcctatgagaaggcggagagtgacatcatg
cacctgcggccacggaacccgaagcgtgacagattggtcaacgagcccctggccgcctac
tcctactttcagattggtgccatccagtcatttgctggcttcaccgactacttcacagcc
atggcccaggagggctggttcccactgctgtgtgtggggctgcggccgcagtgggaggac
caccacctgcaagatctgcaggacagctatggccaggagtggacgttcgggcagcgcctg
taccagcagtacacctgctacaccgtgttctttatcagcatcgaggtgtgccagatagcc
gacgtcctcatccgcaagacacgccgcctttcggccttccagcagggcttcttcaggaat
aggatcctggtgatcgccatcgtgttccaggtctgcattggctgtttcctgtgctactgc
cccggaatgcccaacatcttcaacttcatgcccattcggtaccagtggtggctggtgccc
ctgccctacggcatcctcatctttgtctatgatgaactgcggaagcttggagttcgctgt
tgcccagggagctggtgggaccaggagctctactattag

DBGET integrated database retrieval system