KEGG   Loxodonta africana (African savanna elephant): 100664099
Entry
100664099         CDS       T04351                                 

Gene name
CXCL8
Definition
(RefSeq) interleukin-8
  KO
K10030  interleukin 8
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
lav04061  Viral protein interaction with cytokine and cytokine receptor
lav04062  Chemokine signaling pathway
lav04064  NF-kappa B signaling pathway
lav04072  Phospholipase D signaling pathway
lav04218  Cellular senescence
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04932  Non-alcoholic fatty liver disease
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05132  Salmonella infection
lav05133  Pertussis
lav05134  Legionellosis
lav05135  Yersinia infection
lav05142  Chagas disease
lav05144  Malaria
lav05146  Amoebiasis
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05219  Bladder cancer
lav05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100664099 (CXCL8)
   04072 Phospholipase D signaling pathway
    100664099 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100664099 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100664099 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100664099 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100664099 (CXCL8)
   04621 NOD-like receptor signaling pathway
    100664099 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    100664099 (CXCL8)
   04657 IL-17 signaling pathway
    100664099 (CXCL8)
   04062 Chemokine signaling pathway
    100664099 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100664099 (CXCL8)
   05202 Transcriptional misregulation in cancer
    100664099 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    100664099 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100664099 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100664099 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100664099 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100664099 (CXCL8)
   05135 Yersinia infection
    100664099 (CXCL8)
   05133 Pertussis
    100664099 (CXCL8)
   05134 Legionellosis
    100664099 (CXCL8)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100664099 (CXCL8)
   05171 Coronavirus disease - COVID-19
    100664099 (CXCL8)
   05164 Influenza A
    100664099 (CXCL8)
   05163 Human cytomegalovirus infection
    100664099 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100664099 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100664099 (CXCL8)
   05144 Malaria
    100664099 (CXCL8)
   05142 Chagas disease
    100664099 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100664099 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100664099 (CXCL8)
Cytokines and growth factors [BR:lav04052]
 Cytokines
  Chemokines
   100664099 (CXCL8)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Chemokines
   100664099 (CXCL8)
SSDB
Motif
Pfam: IL8 DUF5527
Other DBs
NCBI-GeneID: 100664099
NCBI-ProteinID: XP_010592444
LinkDB
Position
Unknown
AA seq 105 aa
MSSKLVFVLLAALVLSAALCKAAVLPMVASELRCQCIKTHSTPFHPKYIKELRVIESGPH
CPNSEIIVKIVTKEGEEGKEVCLDPTAKWVQKVVQVFLKRAEKET
NT seq 318 nt   +upstreamnt  +downstreamnt
atgtcttccaagctggtttttgttctcttggcagctcttgtgctttctgcagctctctgc
aaagctgcagttttgccaatggtggcttcagaacttcgatgccagtgtataaagacgcac
tcaacacctttccatcccaaatatatcaaagaactgagagtgatcgagagtggcccacac
tgtccaaattcagaaatcattgtgaaaattgtcacaaaggagggagaggaaggaaaagag
gtctgcctggaccccacagcaaagtgggtgcagaaggttgtgcaggtatttttgaagaga
gctgagaaagaaacatga

DBGET integrated database retrieval system