KEGG   Loxodonta africana (African savanna elephant): 100664103
Entry
100664103         CDS       T04351                                 

Gene name
CDC42
Definition
(RefSeq) cell division control protein 42 homolog
  KO
K04393  cell division control protein 42
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04062  Chemokine signaling pathway
lav04144  Endocytosis
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04510  Focal adhesion
lav04520  Adherens junction
lav04530  Tight junction
lav04660  T cell receptor signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04670  Leukocyte transendothelial migration
lav04722  Neurotrophin signaling pathway
lav04810  Regulation of actin cytoskeleton
lav04912  GnRH signaling pathway
lav04932  Non-alcoholic fatty liver disease
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05100  Bacterial invasion of epithelial cells
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05205  Proteoglycans in cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100664103 (CDC42)
   04014 Ras signaling pathway
    100664103 (CDC42)
   04015 Rap1 signaling pathway
    100664103 (CDC42)
   04370 VEGF signaling pathway
    100664103 (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100664103 (CDC42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100664103 (CDC42)
   04520 Adherens junction
    100664103 (CDC42)
   04530 Tight junction
    100664103 (CDC42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100664103 (CDC42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100664103 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    100664103 (CDC42)
   04670 Leukocyte transendothelial migration
    100664103 (CDC42)
   04062 Chemokine signaling pathway
    100664103 (CDC42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100664103 (CDC42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100664103 (CDC42)
  09158 Development and regeneration
   04360 Axon guidance
    100664103 (CDC42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100664103 (CDC42)
   05205 Proteoglycans in cancer
    100664103 (CDC42)
   05203 Viral carcinogenesis
    100664103 (CDC42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100664103 (CDC42)
   05211 Renal cell carcinoma
    100664103 (CDC42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100664103 (CDC42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100664103 (CDC42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100664103 (CDC42)
   05135 Yersinia infection
    100664103 (CDC42)
   05100 Bacterial invasion of epithelial cells
    100664103 (CDC42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100664103 (CDC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100664103 (CDC42)
   03036 Chromosome and associated proteins [BR:lav03036]
    100664103 (CDC42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100664103 (CDC42)
   04031 GTP-binding proteins [BR:lav04031]
    100664103 (CDC42)
Membrane trafficking [BR:lav04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    100664103 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    100664103 (CDC42)
  Macropinocytosis
   Ras GTPases
    100664103 (CDC42)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100664103 (CDC42)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100664103 (CDC42)
  Exosomal proteins of breast milk
   100664103 (CDC42)
GTP-binding proteins [BR:lav04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100664103 (CDC42)
SSDB
Motif
Pfam: Ras Roc PET117
Other DBs
NCBI-GeneID: 100664103
NCBI-ProteinID: XP_003415279
LinkDB
Position
Unknown
AA seq 144 aa
IQSLTSFCFFPLGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPK
TPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKN
VFDEAILAALEPPEPKKSRRCVLL
NT seq 435 nt   +upstreamnt  +downstreamnt
attcagtccctgacttctttctgttttttccccctagggcaagaggattatgacagatta
cgaccgctgagttatccacaaacagatgtatttctagtctgtttttcagtggtctctcca
tcctcatttgaaaatgtgaaagaaaagtgggtacctgagataactcaccactgtccaaag
acgcctttcttgcttgttgggacccaaattgatctcagagatgacccctctactattgag
aaacttgccaagaacaaacagaagcctatcaccccggagactgctgaaaagctggcccgt
gacctgaaggctgtcaaatatgtggagtgttctgcactcacacagaaaggcctaaagaat
gtatttgacgaagcaatattggctgccctggagcctccagaaccgaagaagagccgcagg
tgtgtgctgctatga

DBGET integrated database retrieval system