KEGG   Loxodonta africana (African savanna elephant): 100664119
Entry
100664119         CDS       T04351                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04015  Rap1 signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04068  FoxO signaling pathway
lav04150  mTOR signaling pathway
lav04270  Vascular smooth muscle contraction
lav04510  Focal adhesion
lav04650  Natural killer cell mediated cytotoxicity
lav04720  Long-term potentiation
lav04722  Neurotrophin signaling pathway
lav04726  Serotonergic synapse
lav04730  Long-term depression
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04928  Parathyroid hormone synthesis, secretion and action
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05034  Alcoholism
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05216  Thyroid cancer
lav05218  Melanoma
lav05219  Bladder cancer
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100664119 (BRAF)
   04012 ErbB signaling pathway
    100664119 (BRAF)
   04015 Rap1 signaling pathway
    100664119 (BRAF)
   04068 FoxO signaling pathway
    100664119 (BRAF)
   04024 cAMP signaling pathway
    100664119 (BRAF)
   04150 mTOR signaling pathway
    100664119 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100664119 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100664119 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100664119 (BRAF)
   04062 Chemokine signaling pathway
    100664119 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100664119 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    100664119 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    100664119 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100664119 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    100664119 (BRAF)
   04720 Long-term potentiation
    100664119 (BRAF)
   04730 Long-term depression
    100664119 (BRAF)
   04722 Neurotrophin signaling pathway
    100664119 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100664119 (BRAF)
   05205 Proteoglycans in cancer
    100664119 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100664119 (BRAF)
   05212 Pancreatic cancer
    100664119 (BRAF)
   05225 Hepatocellular carcinoma
    100664119 (BRAF)
   05226 Gastric cancer
    100664119 (BRAF)
   05214 Glioma
    100664119 (BRAF)
   05216 Thyroid cancer
    100664119 (BRAF)
   05221 Acute myeloid leukemia
    100664119 (BRAF)
   05220 Chronic myeloid leukemia
    100664119 (BRAF)
   05218 Melanoma
    100664119 (BRAF)
   05211 Renal cell carcinoma
    100664119 (BRAF)
   05219 Bladder cancer
    100664119 (BRAF)
   05215 Prostate cancer
    100664119 (BRAF)
   05213 Endometrial cancer
    100664119 (BRAF)
   05224 Breast cancer
    100664119 (BRAF)
   05223 Non-small cell lung cancer
    100664119 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100664119 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    100664119 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    100664119 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100664119 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100664119 (BRAF)
   05160 Hepatitis C
    100664119 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100664119 (BRAF)
   01522 Endocrine resistance
    100664119 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100664119 (BRAF)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100664119 (BRAF)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100664119 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 100664119
NCBI-ProteinID: XP_023394931
LinkDB
Position
Unknown
AA seq 735 aa
MIQLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVS
SSASTDTVTSSSSSSLSVLPSSLSVFQNPTDVSRTNPKSPQKPIVRVFLPNKQRTVVPAR
CGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPL
TTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVS
KFFEHHPIPQEEASLAETALPGSSPPAPPSDARGPQILTSPSPSKSIPIPQPFRPADEDH
RNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDAGSTTGLSATPPASLPGSLTNV
KALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYK
GKWHVPFVGLCPEPVIRQQQTDVCAGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVN
ILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSI
IHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNP
YSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRL
MAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPK
TPIQAGGYGEFAAFK
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgatccagttgacacaggagcacatagaggccctgctggacaagtttgggggggagcac
aacccaccatcaatctatctggaggcctatgaagaatacaccagcaagctagatgccctc
caacaaagagaacagcagctattggaatccctggggaacggaactgatttttctgtttct
agctctgcatcaacggacaccgttacatcttcttcctcctctagcctttcagtgctacct
tcatctctttcagtttttcaaaatcccacagatgtgtcacggaccaaccccaagtcacca
caaaaacctatcgttagagtcttcctgcccaacaaacagagaacagtggtacctgcacgg
tgtggtgtcacagtccgggacagcctgaagaaggcgctcatgatgagaggtctgatccca
gagtgctgtgccgtttacagaattcaagatggagagaagaaaccgattggctgggacact
gatatttcctggctgactggcgaggagttacatgtagaagtgttggagaatgttccactc
acaacacacaactttgtacggaaaacttttttcaccttagcattttgtgacttttgtcga
aagctgcttttccaaggtttccgctgtcagacatgtggttacaagtttcaccagcgttgt
agtacagaggttccgctgatgtgcgttaattacgaccaactggatttgctgtttgtctcc
aagttctttgaacaccacccaatcccgcaggaggaggcctccttagcagagacagcactg
cccggatcgtcccctcccgcacccccctcagacgctcgtgggccccaaattctcaccagt
ccgtctccttcaaaatccattccaattccacagcccttccgaccagcagatgaagatcat
cgaaatcagtttgggcagcgagaccggtcctcgtcggcccccaatgtgcatataaacaca
atagagcctgtcaatattgatgacttgattagagaccaagggtttcgtggtgatgcagga
tcaaccacaggtctgtctgcgacccctcccgcatcactccctggctcgctcactaatgtg
aaagccttacagaaatctcctggacctcagcgggaaaggaagtcctcgtcatcctccgaa
gacaggaatcgaatgaaaacgcttggtaggcgggattcaagtgacgactgggagattcct
gatgggcagatcacagttggacagagaatcggatctgggtcatttggaaccgtctacaag
ggcaagtggcatgttccatttgtaggtctttgtcctgaaccagtaattagacagcagcaa
acagacgtgtgtgcaggtgatgtggcagtgaagatgttgaatgtgacagcacccacacct
cagcagctacaggccttcaaaaatgaagtaggagtcctcaggaaaacacgacatgtgaat
atcctactcttcatgggctactcaacaaagccacagctcgccatcgtcacccagtggtgt
gagggctccagcttgtatcaccatctccacatcattgagaccaaatttgagatgatcaaa
ctcatagacattgcacgacagactgcacagggcatggattacttacacgccaagtcaatc
atccacagagacctcaagagtaataatatatttcttcatgaagacctcacagtaaaaata
ggtgattttggcctagccacagtgaaatctcgatggagtgggtcccatcagtttgaacag
ttgtctggatccattttgtggatggcaccggaagtaatcagaatgcaagataagaacccc
tatagctttcagtcagatgtgtatgcatttgggattgtcctgtatgaactgatgactgga
cagttaccttattcaaacatcaacaacagggaccagataatttttatggtgggacgagga
tacctgtctccagatctcagtaaggtacggagtaactgtccaaaagccatgaagagatta
atggcagagtgcctgaaaaagaaacgagacgagagaccactctttccccaaattcttgcc
tctattgagctgctggcccgctcattgccaaaaattcaccgcagtgcatccgaaccctcc
ttgaatcgggccggcttccaaacagaggattttagtctgtatgcttgtgcttctccaaaa
acgcccatccaggcagggggctacggagaatttgcagccttcaagtag

DBGET integrated database retrieval system