KEGG   Loxodonta africana (African savanna elephant): 100664173
Entry
100664173         CDS       T04351                                 

Gene name
ABHD5
Definition
(RefSeq) 1-acylglycerol-3-phosphate O-acyltransferase ABHD5
  KO
K13699  abhydrolase domain-containing protein 5 [EC:2.3.1.51]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100664173 (ABHD5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100664173 (ABHD5)
   01004 Lipid biosynthesis proteins [BR:lav01004]
    100664173 (ABHD5)
Enzymes [BR:lav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     100664173 (ABHD5)
Peptidases and inhibitors [BR:lav01002]
 Serine peptidases
  Family S33
   100664173 (ABHD5)
Lipid biosynthesis proteins [BR:lav01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   100664173 (ABHD5)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr DUF1071
Other DBs
NCBI-GeneID: 100664173
NCBI-ProteinID: XP_023403582
LinkDB
Position
Unknown
AA seq 334 aa
RSGWLTGWLPTWCPTSTSHLREAEEKILKCVPRTYKKEPVYISNGNKIWTLKLSCNIPNK
IPLVLLHGFGGGLGLWALNFEDLSTNRPVYAFDLLGFGRSSRPRFDSDAEEAENQFVESI
EEWRCALGLDKVILLGHNLGGFLAAAYSLKYPSRVTHLILVEPWGFPERPDLADQDRPIP
VWIRALGAALTPFNPLAGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDDTVTEYIYHCNVQ
TPSGESAFKNMTIPYGWAKRPMLQRIGKMHTDIPVSVIYGARSCIDGNSGTTIQSLRPHS
YVKTIAILGAGHYVYADQPEEFNQKVKEICDTVD
NT seq 1005 nt   +upstreamnt  +downstreamnt
aggtcaggatggcttactggttggcttcccacgtggtgccctacgtctacatcacacctt
agagaagctgaagagaaaattttaaaatgtgttccccgcacatacaaaaaagaacctgtt
tatatatctaatggaaataaaatatggacactgaaattatcctgtaatattccaaataaa
ataccacttgtcctccttcatggttttggaggaggacttggactctgggcgctaaatttt
gaagatctttctaccaataggcccgtctatgcatttgacctgttgggctttggacgaagt
agtagacccaggtttgacagtgatgcagaagaagcagagaatcagtttgtggaatccatc
gaagagtggagatgtgccctaggattggacaaagtgattttgcttggacacaacctgggt
gggttcttggctgctgcttactcactaaagtacccatcaagggttactcatctcatttta
gtggagccttggggtttccctgagagacctgatcttgctgatcaagacagaccaattcct
gtttggatcagagccttgggagctgcattgactccctttaaccccctagctggcctcaga
atcgcaggaccctttggtttaagtttagtgcaacgtttaagacctgatttcaagcggaag
tactcttcgatgtttgaagatgataccgtgacagaatacatctaccactgtaatgtacag
acgcccagtggcgagtcagctttcaaaaatatgactattccttatggatgggcaaaaagg
ccaatgctccagcggattggtaaaatgcacactgacattccagtttcggtgatctacggc
gcccgatcctgcatagacggcaattctggcaccaccatccagtcattacgcccacattca
tacgtgaagacgatagccatccttggagcagggcattatgtgtacgcagaccaaccggaa
gagttcaaccagaaagtaaaggagatctgtgacaccgtggactga

DBGET integrated database retrieval system