KEGG   Loxodonta africana (African savanna elephant): 100664247
Entry
100664247         CDS       T04351                                 

Gene name
AHR
Definition
(RefSeq) aryl hydrocarbon receptor
  KO
K09093  aryl hydrocarbon receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04659  Th17 cell differentiation
lav04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100664247 (AHR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100664247 (AHR)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100664247 (AHR)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH UPF0688 PAS_4 PAS_9
Other DBs
NCBI-GeneID: 100664247
NCBI-ProteinID: XP_003407139
LinkDB
Position
Unknown
AA seq 847 aa
MNSSSANITYASRKRRKPVQKTVKPVPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDV
INKLDKLSVLRLSVSYLRAKSFFDVALKSSPADRNGGQDNCRTKVREGLNFQEGEFLLQA
LNGFVLVVTVDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWSLNPS
QSIDSGQRLDDANGLSQPTVYYNPDQLPPENSSFMERCFICRLRCLLDNSSGFLAMNFQG
RLKYLHGQNKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPTGCD
AKGRIILGYTEAELCMRGSGYQFLHAADMLYCAENHIRMIKTGESGMTVFRLLTKENRWT
WVQSNARIVYKNGRPDYIIATQRPLTDEEGAEHLRKRSMKLPFMFTTGEAVLYEVASPFP
PIMDPLPIRAKSSAKDSAVKSTSNKDSVDPSSLLGAVMRQDESVYRYPASNTVPFERNFL
NRSVNECSNWEDNIAPMENDNILKHEQISHSQEMNLLLSGGHAGLFPDNKNSELYSMMKN
LGIDFEDIRHMQQNEEFFRADFSGEDDFRDIDMADEILTYVQDSLNKSTFMCSGYQQQQP
MALNSSCMVQEHLQLEQQQQLQHHQKQGVEQQQQLCQKMEHMQVNGVFADWNSNQPMPFS
CPQQDLQQYDVFSDLPGTDQEFPYKSEIDIMPYTQNFIPYNQSVLPQHSKCTQLDFPIGN
FEPSPYPSTSSSFEGFVHCLQVPENQEHGINPQATVVTPQTCYAGAVSMHRCQPETQHTR
LDQMQYNPAMPGPQTFLNEFQNGGVLNETYPAELSNINNTQTTPHLQPLHHPSEAGPFPD
MPSSGFL
NT seq 2544 nt   +upstreamnt  +downstreamnt
atgaacagcagcagcgccaacatcacctacgccagtcgcaagcggcggaaaccggtgcag
aaaacagtaaagccagtcccggctgaaggcatcaaatcgaacccatccaagagacataga
gaccgacttaatacagagttggaccgtttggctagcctactgccttttccacaagatgtt
attaataagctggacaaactttcagttcttaggctcagtgtcagttacctaagagccaaa
agcttctttgatgttgcgttaaaatcctccccagctgacagaaatggaggccaggataac
tgtagaacaaaagtcagagaaggcctgaacttccaagaaggagagttcttattacaggct
ctgaatggatttgtgctggtcgtcactgtagatgctttggtcttttatgcttcatctact
atacaagattacctggggtttcagcagtctgatgtcatacatcagagcgtgtatgaactt
attcatactgaagaccgtgctgaatttcagcgtcagctacactggtcattaaacccttca
cagagcatagactctggacaaagacttgatgacgctaatggtctttcacagccaactgtc
tattataacccagaccagcttcctccagaaaactcttcctttatggagaggtgcttcata
tgccgactaaggtgcctgctggataattcatctggttttctggcaatgaatttccagggg
aggctaaagtatcttcacggacagaacaagaaagggaaagatggatcgatacttccacct
cagctggctttgtttgcaatagctactccacttcagccaccatccatacttgaaatccga
accaaaaatttcatctttagaactaaacacaaactagactttacacctactggttgtgat
gccaaaggaagaattattttaggatacactgaagcagagctgtgcatgagagggtcagga
tatcagtttcttcatgctgctgatatgctttattgtgccgagaaccacatccggatgatt
aagactggagagagtggcatgacagtgttcaggcttcttaccaaagaaaatcggtggacg
tgggttcagtctaatgcacgcatagtttataaaaatggaagaccagactatatcattgca
actcaaagacctctaacagatgaagaaggagcagagcatttaagaaaacgaagtatgaag
ttgcctttcatgtttaccactggagaagctgtgttatatgaggtagccagcccttttcct
cccataatggatcccttaccaataagggctaaaagtagtgcaaaagactctgctgttaaa
tcaacttcaaataaggattctgtcgatcccagttccctcctgggtgcagtcatgcgacaa
gatgagtctgtttatcgctatccagcttcaaatactgtaccctttgaaagaaacttttta
aacagatccgttaatgaatgcagtaattgggaagataatattgcaccaatggaaaacgat
aatattctgaaacatgagcagattagtcactctcaggaaatgaacctgctactctctgga
ggtcatgcggggctctttccagataataaaaatagtgagttgtacagcatgatgaaaaac
ctaggcattgactttgaagacatcagacacatgcagcagaacgaggaatttttcagagct
gacttttctggtgaggatgacttccgagacattgacatggcggatgaaatcctgacgtat
gtccaagattctttaaataagtctaccttcatgtgttcaggttaccaacagcagcaaccc
atggccctaaactcaagctgtatggtacaggagcacctacagttagaacagcagcagcag
ctacagcaccaccaaaagcaaggagtggagcagcagcaacaactgtgtcagaagatggag
catatgcaagttaatggcgtgtttgcagattggaactctaaccagcccatgccttttagt
tgtcctcagcaagacctacaacagtatgatgtcttttcagacttacctgggaccgatcaa
gaatttccctacaaatctgagatcgatattatgccttatacacagaactttattccttat
aatcagtctgtgttaccacaacattccaaatgtactcagttggactttcctatagggaat
tttgaaccatccccataccctagtacgtcttctagtttcgaaggttttgtccattgttta
caagttcctgaaaaccaagaacatggaataaatccacaagcaactgtagtgactcctcag
acctgttacgccggggccgtatcaatgcatcggtgccagcctgaaactcagcacacccgg
ctggatcagatgcagtacaatccagcaatgccaggaccacagacatttctaaacgagttc
cagaatggaggcgttttaaatgaaacatatccagctgaattaagtaacataaataacact
cagactaccccacatctccagcctcttcatcatccatcagaagccggacctttccctgat
atgccatccagtggatttctgtaa

KEGG   Loxodonta africana (African savanna elephant): 104847035
Entry
104847035         CDS       T04351                                 

Definition
(RefSeq) aryl hydrocarbon receptor-like
  KO
K09093  aryl hydrocarbon receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04659  Th17 cell differentiation
lav04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    104847035
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104847035
Transcription factors [BR:lav03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    104847035
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS HLH PAS_9 PAS_4
Other DBs
NCBI-GeneID: 104847035
NCBI-ProteinID: XP_023396132
LinkDB
Position
Unknown
AA seq 843 aa
MGHGSHVSCKYHSAWHSIGAPRLVTESKNDITEERVMITTFLFSPSPKPQPPEGAKSNPS
KRHRDRLNQELSKLTHLLPFPEDVRARLDKLSILRLIVGYLKMKGYFSGKCCWHAGCSAN
PPVNPGGSEHASPQINAELFSEGDLLLQALNGFLMAVTEDGYVFYVSPTVQDYLGFHQSD
VIYQSVFELIHKEDRPMFQSQLRWSPDPEPVSKEAKEDTSPLPGKKFQPLSGAAIDGRQH
PSLEDPPCLERSFVCRFRCLLDNSPGFLELHFHGHLKCLPGQNNRSEDGTLVSSQLTLFA
IATPHQPLTMLELQTKTFLFQTKHKLDFTPIACDSRGKVALGYTESELCRRGSGYQFIHP
ADMMHCAEKHLQLIRTGESGLTVFRLLTKQASWLWVQSDARLVFRGGQPDCIVARQRVLT
NAEGEEHLRKRALELPFTFTTGEAILYEKSLPGLLTTLPARKRSRSRKGHPTDQEGPVHP
GSLLRATRQQDESMCLSCIAPTPQGSSLDRWGPDDRCEDEEEEEGEEGRSLLALIETLLE
KDTGEPPDLCFTLRHLGVADLEKHPWEENLLGAESDPAGPQNCHLLPRSQGGEPQREEGA
LFPEGLHVSLSLTASTTPPPILRPRSSLSSGHLAMEMTPPRKLGTEPSPSQAYLQHFLVS
GQTTPGPTCQSPPQNPPQQQPGHSQLAPLTFGMSQKQTISDHRSVASPPPEASSPRRPAQ
MFELSYAATLSLGENVFGHLAHPASGVLDFCEESVPGTPTHSGQCQEPLMTSDPTLRAIS
CGSHLSGGIWDTPIQGQPVMVPMEVGQLETFLPTWAGASPYGCGEQQGHQRKHLGVKSIH
PVL
NT seq 2532 nt   +upstreamnt  +downstreamnt
atgggacatgggtcacatgtgtcctgcaaataccatagcgcctggcacagcattggagcc
ccaaggttggttaccgagtccaagaatgacattacagaggaacgtgtgatgataaccact
tttctcttttccccaagtcctaagccacaacctcctgagggagccaagtccaacccttct
aaaaggcaccgggaccgcctcaatcaggagctgagcaaactgacccacttgctgcccttc
cccgaggacgtgcgagcccgcctggacaaactctccatcctcaggctcatcgtgggctac
ctgaagatgaagggctacttctcaggtaagtgttgctggcatgcaggctgttcagccaac
ccacccgtgaacccagggggaagtgaacatgcctctccacagatcaatgcagagctattt
tctgaaggggacttgcttcttcaggccctcaatggctttctcatggctgttacagaagat
ggctatgttttctacgtctctcccacagtccaggactacctgggatttcaccagtcagat
gtcatctatcagagtgtgtttgagctgatccacaaggaggatagacccatgttccagagc
cagttacgctggtcaccagacccagaacccgtcagcaaagaggccaaggaggacaccagc
cctctgcctggaaagaaatttcagccccttagtggagccgccattgacggccgtcagcat
ccgtccttggaagaccctccctgtctggagagaagctttgtttgccgattccgctgccta
ctggacaactctcctgggtttctggaattgcatttccatggccatcttaaatgcctccct
gggcagaacaacaggtcagaagatggcacccttgtgtcttctcagcttaccctgtttgcc
attgcgacgccccaccagcctctcaccatgttggagctccaaaccaaaacatttcttttt
caaacaaaacataaattagatttcacacctatagcctgcgattccagaggcaaggtggcc
ctgggctacacggagagtgagctctgcagaaggggatcgggttaccagttcatccaccca
gccgacatgatgcactgtgctgagaaacacttgcagttgatacgaacgggcgagagcggt
cttacggtgttccggctactcaccaagcaggccagctggctgtgggtgcagtccgacgcc
cgcctggtgttccgtggtggccagccagactgcattgttgccagacagcgggtgctaacg
aatgcggagggggaggagcacctgcgaaagcgggccctggagctgccgttcaccttcacc
accggggaagccatcctgtatgagaagagcctcccaggcctcctgaccactctccctgcc
aggaagaggtccaggtcaaggaagggccatcccactgaccaggagggcccagtgcaccca
ggatcgctcctcagagccacgagacagcaagatgaatccatgtgcttgtcctgcattgcc
cccaccccccaaggctcatccttggataggtgggggcctgatgatagatgtgaggacgag
gaggaggaagagggggaggaaggccgctccctcctagccctcatcgagaccctgctggag
aaggacacgggagaaccaccagacctctgtttcacccttcggcacctgggggtcgccgac
cttgagaagcatccatgggaagagaaccttcttggggctgaatcagaccctgcagggcct
caaaactgccacctgctgccacgcagccagggaggagagccccagagggaggagggggca
ctttttcctgagggcttgcatgtgagcttgtccttgacggccagcacaactcccccacca
atcctgaggcctcggtcttctctgagctcgggccatctagccatggagatgactccgcct
cggaagctgggcactgagcccagcccctctcaggcctatctccagcattttcttgtctct
ggccagaccacccctggccccacatgccagagcccacctcaaaaccctccacagcagcag
cctgggcacagtcagttagcacctttgacctttggtatgagccagaaacaaacaatatct
gaccacagaagtgttgccagcccaccgcctgaggcttccagccccagacggcctgcccag
atgtttgagctgagctatgcagctacactgtctttaggagaaaatgtctttgggcacctg
gctcacccagcctctggtgttttggatttttgcgaggaatctgtgcctgggacacccaca
cacagtggtcagtgtcaggagcccctgatgacctcagaccccaccctccgtgccatttcc
tgtggctcccatctctcaggcggcatttgggatacccccatccagggccagccagttatg
gtccccatggaagtgggccagctggagacgttcctcccaacttgggcaggggccagcccc
tatgggtgcggggagcagcagggacaccagaggaaacacctgggggtcaagagtatccac
cccgttctctga

DBGET integrated database retrieval system