KEGG   Loxodonta africana (African savanna elephant): 100664370
Entry
100664370         CDS       T04351                                 

Gene name
RGS2
Definition
(RefSeq) LOW QUALITY PROTEIN: regulator of G-protein signaling 2
  KO
K18154  regulator of G-protein signaling 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04740  Olfactory transduction
lav04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100664370 (RGS2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100664370 (RGS2)
  09157 Sensory system
   04740 Olfactory transduction
    100664370 (RGS2)
SSDB
Motif
Pfam: RGS COMPASS-Shg1
Other DBs
NCBI-GeneID: 100664370
NCBI-ProteinID: XP_003410879
LinkDB
Position
Unknown
AA seq 213 aa
MMRGSMFLAVQHEYCGPVDKSAGSGAKSEEKREKMKLTLLKDWKARLSYFLQNSSTPGKP
KTSKKSKQQTFIKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACED
FKKTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVY
SLMENNAYPRFLESEFYQDLCKKPQITTVPHAT
NT seq 642 nt   +upstreamnt  +downstreamnt
atgatgcgaggttccatgttcctggctgtccagcacgagtactgtggtccagtggacaag
agcgcaggcagtggcgccaagagcgaggagaagcgggagaagatgaagctaaccctgtta
aaagattggaaggcccgtttgagctacttcttacaaaattcctccactcctgggaagccc
aaaaccagcaagaaaagcaaacagcaaacttttatcaagccatctcctgaggaagcacag
ctgtggtcagaagcgtttgatgagctgctagccagtaaatatggtcttgctgcattcagg
gcttttttaaaatctgaattctgtgaagaaaatattgaattctggctggcctgtgaagat
ttcaaaaaaaccaagtcaccccaaaagctgtcctcaaaagcaaggaaaatatatactgac
ttcatagaaaaggaagctccaaaagagataaacatagactttcaaaccaaaactctaatt
gcccaaaatatacaagaggctacaagtggttgctttacaactgcacagaaaagagtatac
agcttgatggagaacaacgcttatccccgcttcttggagtcagaattctaccaggacttg
tgtaaaaagccacagatcaccacagtgccccatgctacatga

DBGET integrated database retrieval system