KEGG   Loxodonta africana (African savanna elephant): 100664539
Entry
100664539         CDS       T04351                                 

Gene name
RPS6
Definition
(RefSeq) 40S ribosomal protein S6
  KO
K02991  small subunit ribosomal protein S6e
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav03010  Ribosome
lav04066  HIF-1 signaling pathway
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04371  Apelin signaling pathway
lav04714  Thermogenesis
lav04910  Insulin signaling pathway
lav05171  Coronavirus disease - COVID-19
lav05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    100664539 (RPS6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100664539 (RPS6)
   04066 HIF-1 signaling pathway
    100664539 (RPS6)
   04151 PI3K-Akt signaling pathway
    100664539 (RPS6)
   04150 mTOR signaling pathway
    100664539 (RPS6)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100664539 (RPS6)
  09159 Environmental adaptation
   04714 Thermogenesis
    100664539 (RPS6)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100664539 (RPS6)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100664539 (RPS6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100664539 (RPS6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lav03011]
    100664539 (RPS6)
Ribosome [BR:lav03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    100664539 (RPS6)
  Archaea
    100664539 (RPS6)
SSDB
Motif
Pfam: Ribosomal_S6e
Other DBs
NCBI-GeneID: 100664539
NCBI-ProteinID: XP_003407709
LinkDB
Position
Unknown
AA seq 410 aa
MPVLPSSFGTAERSVRDRRGAPPGHSCRAHASAGKLRLAPTSHLARTVLPYVTRLSGSWV
FFVAPGRDRLLHMKEEVVVGSGRLGFLIALRARVTQSAPDPDPDESLRQEKDRLSDDQSF
LGERMTSDCGGRGAGLGAPWWRPRAQPGQRRACCRFCKRPVVQLNISFPATGCQKLIEVD
DERKLRTFYEKRMATEVAADSLGDEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSK
GHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPELTDTTVPRRLGPKRAS
RIRRLFNLSKEDDVRQYVVRKPLNKEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQRT
KKNKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESSQK
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgccagtcctcccctcgtcctttggtaccgccgagagaagtgtccgggaccgacgtggg
gctccgccggggcacagctgtagggcccacgcgagcgcgggtaaactccggctagctccg
acatcgcatctcgcgagaactgtgctcccctatgtgacccggctgagcggaagttgggtc
tttttcgtggcgccgggaagagaccggctgcttcacatgaaggaggaagtggtggtgggg
tccggtaggctggggttcttgattgcgctcagagcgcgcgtgacgcagtccgcaccagat
cccgaccctgatgagagtctgcggcaggagaaagatcggctctcggacgaccagagcttt
ttaggagagcggatgacgagcgattgcggcgggagaggtgccgggctgggagcgccatgg
tggcgtcctcgagcccagcctgggcagaggcgtgcctgctgccggttttgcaagaggcct
gtcgtgcagctgaacatctccttcccagccactggctgccagaaactcattgaagtggac
gatgaacgcaaacttcgtacgttttatgagaagagaatggccacagaagttgctgctgac
tctctgggtgatgaatggaagggatatgttgtccgaatcagtggtgggaacgacaagcaa
ggttttcccatgaagcagggtgtcttgacccacggccgcgtccgcctgctgctgagtaag
gggcattcctgttacagaccaaggagaactggagaaagaaagcgcaaatctgtccggggt
tgcattgtggatgccaatctgagtgttctcaacttggttattgtaaaaaaaggggagaag
gatattccggagttgactgatactactgtgccccgtcgcctggggcccaaaagagctagc
agaatccgcagacttttcaatctctccaaagaagatgatgtccgccagtatgtcgtgaga
aagcccttgaacaaagaaggcaagaaacccaggaccaaagcacccaagattcagcgtctt
gttactccacgtgtcctgcaacacaagcgacgacgtatcgctctgaagaagcagcgcact
aagaaaaataaggaggaggccgcggaatatgccaagcttctggccaagagaatgaaggag
gccaaagaaaaacgacaggagcagatcgctaagagacggaggctgtcctctctgagagct
tctacctctaagtctgaatccagtcaaaaataa

DBGET integrated database retrieval system