KEGG   Loxodonta africana (African savanna elephant): 100664562
Entry
100664562         CDS       T04351                                 

Gene name
RCHY1
Definition
(RefSeq) LOW QUALITY PROTEIN: RING finger and CHY zinc finger domain-containing protein 1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04115  p53 signaling pathway
lav04120  Ubiquitin mediated proteolysis
lav05162  Measles
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100664562 (RCHY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100664562 (RCHY1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100664562 (RCHY1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100664562 (RCHY1)
Enzymes [BR:lav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100664562 (RCHY1)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100664562 (RCHY1)
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 Prok-RING_4 zf-C3HC4_3 zf-RING_11
Other DBs
NCBI-GeneID: 100664562
NCBI-ProteinID: XP_003414198
LinkDB
Position
Unknown
AA seq 261 aa
MATTAREDGACGQEQVRRGCEHYDRGCLLKAPCCDKLYTCRLCHDNNEDHQLDRFKXKEV
QCINCEKXQHAQQTCEECSTLFGEYYCSICHLFDKDKKQYHCESCGICRIGPKEDFFHCL
KCNLCLAMNLQGKHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEG
YRCPLCMHSALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKC
KICESYNTAQAGGRRLSLDQQ
NT seq 786 nt   +upstreamnt  +downstreamnt
atggcgactacggcgcgggaagatggcgcctgcggtcaagagcaagtgcggcggggctgc
gaacattatgacagaggatgtctcttgaaggcaccttgctgtgacaaactttatacttgc
cggctgtgtcatgataacaatgaagatcatcagctagaccgctttaagnntaaggaagtg
cagtgcataaactgtgaaaaanttcagcatgcccagcagacttgcgaagaatgtagcaca
ttgtttggagaatattattgtagtatatgccatctatttgacaaagacaagaagcagtat
cattgcgaaagctgtggaatttgtaggattggtccaaaggaagattttttccactgtttg
aaatgtaacttatgcctagctatgaatctccaaggaaaacacaagtgtattgaaaatgtc
tcccggcagaattgtccaatatgtctggaggatattcacacatctcgtgttgttgctcat
gtcttgccatgtggacatcttttacacagaacatgctatgaagaaatgttgaaagaaggc
tacagatgcccattatgtatgcactcggctttagacatgacgaggtactggagacagctg
gatgatgaggtagcacagactcctatgccatcagagtatcagaacatgactgtggatatt
ctctgcaatgattgcaatggacgatccacagtccagttccatatattaggcatgaaatgt
aagatttgtgaatcctacaatactgctcaagctggaggacgtagactctcactagaccag
caatga

DBGET integrated database retrieval system