KEGG   Loxodonta africana (African savanna elephant): 100664597
Entry
100664597         CDS       T04351                                 

Gene name
PDE2A
Definition
(RefSeq) cGMP-dependent 3',5'-cyclic phosphodiesterase
  KO
K18283  cGMP-dependent 3',5'-cyclic phosphodiesterase [EC:3.1.4.17]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04022  cGMP-PKG signaling pathway
lav04740  Olfactory transduction
lav04925  Aldosterone synthesis and secretion
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100664597 (PDE2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100664597 (PDE2A)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    100664597 (PDE2A)
  09157 Sensory system
   04740 Olfactory transduction
    100664597 (PDE2A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100664597 (PDE2A)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     100664597 (PDE2A)
SSDB
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3
Other DBs
NCBI-GeneID: 100664597
NCBI-ProteinID: XP_023394813
LinkDB
Position
Unknown
AA seq 1190 aa
MGQACGHSILCRSQQYPAARPAEPLVILAMERAQTALALIFVGDRHTQAQAMNLVGPVAG
TAEGGDPQGTGTCGTTRYPAAATLQVSTHLVQLLSPTVTEENHRFQQSRAGVQLVPGRNL
PSSVPAPLKPLPLAPPPSAPQIRELAGTPLHRRQHPQGVKTINWSVTEPMWNCVYVTVWG
DTVDPRSMGCDTEGEGHPGESDRGGITVCDPVVTPTHSLMPIQEPPELHPPPVFSGEHGK
EEVETSIQWTCEGQDQGAESSSRGKGTRAGLGFWEDRTRAGLGDRVATWRVGEEWAGETG
AGGNRECGRVRDGEREEMPSERKREDAEVGKDAEPHGDETREPLVTERWKLAVADALLSL
GSVIDIAGLQQAVKEALSAVLPRVETVYTYLLDGESRLVCEDPPHELLQEGKVREAVISQ
KRLGCNGLGPSDLPGKPLARLVAPLAPGTQVLVIPLVDKEAGAVAGVILVHCGQLSDSEE
WSLQLYDLDASSLQLKVLQYLQQETGASRCCLLLVSEDNLQLSCKVIGEKVLEEEISFPL
TMGRLGQVVEDKKSIQLKDLTSEDVQQLQNVLGCGLQAMLCVPVISRATDQVVALACAFN
KLGGDLFTEQDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVS
VLLQEIITEARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVAT
TGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSK
FDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLYNGIQ
PVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYR
DPPYHNWMHAFSVSHFCYLLYKNLELANYLEDIEIFALFISCMCHDLDHRGTNNSFQVAS
KSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLA
HHLRIFKDLQKMAEVGYDRTNKQHHSLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFF
SQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASN
REHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPKMDGAGGPVNGCCSLDAE
NT seq 3573 nt   +upstreamnt  +downstreamnt
atggggcaggcgtgcggccactccatcctctgcaggagccagcagtacccggcagcgcga
ccggctgagccgcttgtcatcctggccatggagagggctcagacagcccttgccctcatc
tttgttggagacaggcacacccaggcccaggcaatgaacctggtggggccagttgcaggc
acggctgagggaggagatccccagggcacaggaacatgtggcacaaccagataccctgcc
gcagccaccctacaagtgtccacacacctggtgcagctcctgtcacctaccgtcactgag
gagaaccacagattccagcagtcacgggcaggcgtccagctcgtgccaggccgcaacctc
ccttcatccgttcctgcccccctaaaacccctcccactggctcctcccccctcagctcct
caaatccgagaactggctgggacccccttgcacaggagacagcacccccagggagtaaag
acaatcaactggagtgtgacagagccaatgtggaactgtgtgtatgtcaccgtgtggggt
gacactgtggacccccggagcatggggtgtgacaccgagggtgagggccatcctggtgag
agtgaccggggtggtatcactgtgtgtgaccctgtggtgacccccacccactccctcatg
cccattcaggagccaccagagctacacccacccccagtcttcagtggggaacacgggaag
gaggaggtggagacgagcatccagtggacatgcgaagggcaagaccagggagcagaatcc
agcagccggggcaagggcacgagagcaggcctgggcttctgggaggaccggaccagggct
gggttgggggacagggtggctacttggagggttggggaggagtgggcaggagagacagga
gcgggtgggaacagggagtgtgggagagtgagagatggcgagcgggaggagatgccatct
gagaggaagagagaggatgcggaggtgggaaaagatgcagagcctcatggagatgagaca
cgggagccgcttgtgacagagagatggaagctggctgtggcagatgctttgctgagctta
ggctctgtcatcgacattgcgggccttcaacaggctgtcaaggaggccctgtcagctgtg
ctccccagagtggagacggtctacacctacctgctggatggggagtccaggctggtgtgt
gaggaccctccgcatgagctgctccaggaggggaaagtccgagaggctgtgatctcccag
aaacggctgggctgcaatggactgggcccttcagacctgccagggaagcccttggccaga
ctggtggctccactggcccctggcacccaagtgctggtcataccgctggtggacaaggag
gccggggctgtggctggtgtcatcttggtgcactgtggccagctaagtgacagtgaggag
tggagcctgcagctctacgacctggacgcctcttccctgcagctgaaagttctccaatac
ctgcagcaggagaccggggcatcccggtgctgcctcctgctggtgtccgaggacaacctt
cagctttcctgcaaggtcattggagaaaaagtgctggaggaagagatcagctttccactg
acaatgggtcgcctgggccaggtggtggaagacaagaagtccatccagctgaaggacctc
acctctgaggatgtgcaacagctgcaaaacgtgctgggctgtgggctgcaggccatgctc
tgtgtccctgtcatcagccgggccactgaccaggtggtggccttggcctgcgccttcaac
aagcttggaggagacttgttcacagaacaggatgagcacgtgatacagcactgtttccac
tacacaagcaccgtgctcaccagcaccttggccttccagaaggagcagaaactcaagtgt
gagtgccaggctcttctccaagtggcaaagaacctcttcactcacctggatgacgtctct
gtcctgctccaggagatcatcaccgaggccagaaacctcagcaatgcggagatctgctcc
gtgttcctgctggatcagaacgagttggtggccaaggtgttcgacgggggcgtggtggat
gatgagagctacgagatccgcatcccggccgaccagggcatcgcgggccacgtggcgacc
actggccagatcctgaacatcccggacgcgtacgcgcacccgcttttctaccgcggcgtg
gacgacagcactggcttccgcacgcgcaacatcctctgctttcccatcaagaatgagaac
caggaggtcatcggcgtggccgagctggtgaacaagatcaatggaccttggttcagcaag
ttcgacgaggacctggcgacagccttctccatctattgtggcatcagcatcgcccactcc
ctcctgtacaaaaaagtcaacgaggcccagtatcgcagccacctggccaacgagatgatg
atgtaccacatgaaggtctctgacgacgagtacaccaaacttctgtataacgggatccag
cctgtggctgccattgactccaactttgcgagtttcacctacacccctcgatctctgccc
gaggatgacacgtccatggctatcctgagcatgctgcaggacatgaatttcatcaataac
tacaaaatcgactgcccaacactggcccggttctgtttgatggtgaagaaaggctaccgg
gaccccccctaccacaactggatgcacgccttttctgtctcccacttctgttacctactc
tacaagaacctggagctggcaaactacctcgaggacattgagatcttcgccttgtttatt
tcctgcatgtgtcatgacctggaccacagaggcaccaacaactccttccaggtggcctcg
aaatctgtgctggctgcactctacagctccgagggctctgtcatggagaggcaccacttc
gctcaggccatcgccattctcaacacccacggttgcaacatcttcgaccacttctcccgg
aaggactatcagcgcatgctggacctgatgcgggacatcatcttggccacagacttggca
caccacctccgtatcttcaaggatctccagaagatggctgaagtgggctatgaccgaacc
aacaaacagcaccacagcctcctcctctgcctccttatgacctcctgtgacctctctgac
cagaccaagggctggaagaccacaagaaagattgcagagctgatctacaaagagttcttc
tcccagggagacttggagaaggccatgggcaacaggccgatggagatgatggaccgggag
aaggcctacatccctgagctgcagatcagcttcatggagcacatagcaatgcccatctac
aagcttctgcaggacctgttccccaaggcggcagagctgtatgagcgtgtggcctcaaac
cgtgagcactggaccaaggtgtcccacaagttcaccatccgaggcctcccaagcaacaac
tcactggactttctggatgaggagtacgaggtgcccaagatggatggtgctgggggccct
gtcaatggctgctgcagccttgacgctgagtga

DBGET integrated database retrieval system