KEGG   Loxodonta africana (African savanna elephant): 100664614
Entry
100664614         CDS       T04351                                 

Gene name
STK10
Definition
(RefSeq) serine/threonine-protein kinase 10
  KO
K08837  serine/threonine kinase 10 [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100664614 (STK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100664614 (STK10)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100664614 (STK10)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: STE group
  STE20 family
   100664614 (STK10)
SSDB
Motif
Pfam: PKK Pkinase PK_Tyr_Ser-Thr zf-CCCH_8
Other DBs
NCBI-GeneID: 100664614
NCBI-ProteinID: XP_003404705
LinkDB
Position
Unknown
AA seq 967 aa
MAFANFRRILRLSTFEKRKSREYEHVRRDVDPNEVWEIVGELGDGAFGKVYKAKNKETGA
LAAAKVIETKSEEELEDYIVEIEILATCDHPYIVKLLGAYYYDGKLWIMIEFCPGGAVDA
IMLELDRGLTEPQIQVICRQMLEALNFLHGKRIIHRDLKAGNVLMTLEGDIRLADFGVSA
KNLKTLQKRDSFIGTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHEL
NPMRVLLKIAKSEPPTLLTPAKWSVEFRDFLKVALDKNPETRPSAAQLLEHPFVSSITSN
KALRELVAEAKAEVMEEIEDGRDEGEEEDSVDVTSPQGAHTRNPSEVSQLSLDADKPLKE
PSSTLPTPIEPQENVNGPCSEPSGDRSLQATSPPVVAPGNENGLAVPAPLRKSRPVSMDA
RIHIAEEKQITDLGDLSPAVNRSQKASQNRPNSSALETLGDEKLANGSLEPPTQTAPGPS
ERDSGCGSLSISEGMDYSTSLSTDLSLNKESGSLSIKDSKLYNKTLKRTRKFVVDGVEVS
ITTSKIIGDDEKKDEEMRFLRRQELRELRLLQKEEHRNQTQLSRKHELQLEQMQKRFEQE
INTKKKYFDVELENLERQQKQQVEKMEQEHAVRRREEAKRIRLDQERDYARFQEQFKLMK
KEVKSEVEKLPRQQRKENMKQKMEEHAQKKQLLDQDFLAKQKDDLELAMKRITAENRREI
CDKERECLSRKQELLRDREAALWEMEEHHLQERHQLVKQQLKDQYFLQRHELLRKHEKER
EQMQRYNQRMMEQLKVRQQQEKARLPKIQRSEGKTRMAMYKKSLHINGGGSASEQREKIK
QFSQQEEKRQKSERLQQQQKHENQMRDMVVQCESNTNELQQLQNEKCHLLVEHETQKLKA
LDESHNQTLKEWRDKLRPRKKALEEELNQKKWEQEMFFKLSEEAECLNPPTPSKATKFFP
HSSADAS
NT seq 2904 nt   +upstreamnt  +downstreamnt
atggctttcgccaatttccgtcgcatcctgcgcctgtccaccttcgagaagagaaagtcc
cgcgaatatgagcacgtccgccgggacgtggaccccaatgaggtgtgggagatcgtgggc
gagttgggcgacggcgccttcggcaaggtttataaggccaagaacaaggagacaggcgcc
ttggctgcagccaaagtaattgagaccaagagtgaggaggagctggaggactacatcgtg
gagatcgagatcctggccacctgcgaccacccctacatcgtgaagctcttgggagcctac
tactatgatggaaagctgtggatcatgatcgagttctgtcccgggggagccgtggacgcc
atcatgctggagctggacagaggcctcaccgagccccagattcaggtcatttgccgccag
atgctggaagccctcaacttcctccatggcaagaggatcatccaccgagatctgaaagct
ggcaatgtgctgatgaccctcgagggcgatatcaggctggctgactttggtgtatctgcc
aagaatctgaaaactctgcagaaacgagattccttcataggaacgccttactggatggca
cctgaggtggtgatgtgtgagaccatgaaggacaccccatacgattacaaagccgacatc
tggtccttgggcatcaccctgattgagatggcccagatcgagcccccacaccatgaactc
aaccccatgcgggtcctgctcaaaatcgccaaatcagagccgcccacgctgctcacccct
gctaagtggtcagtggagttccgagacttcctgaaggtagccctggataagaacccagaa
acccggcccagtgctgcacagcttctagagcaccccttcgtcagcagcatcaccagtaac
aaggctctgcgggaactggtggcggaggccaaggccgaagtgatggaggagattgaagat
ggccgggatgagggagaagaggaggactcggtggatgtcacctcgcctcagggggcccac
actcggaacccttccgaagtgagtcagctgagccttgatgccgacaaacctctcaaagaa
ccatcttccaccctgccaacacccatcgagcctcaggagaatgtgaatgggccctgcagc
gagccctctggggacagatccctccaagccactagccccccagttgtggcccctggaaat
gagaatggcctagctgtgcctgcacccctgcggaagtcccggccagtgtcaatggatgcc
aggattcacatagctgaggagaagcaaatcactgacttgggggacctcagtccagcagtc
aacaggtcccaaaaggcaagccagaaccggcccaacagcagcgccctggagaccttgggt
gatgagaagctggccaatggcagcctggagcccccgacccagacggctccaggcccatcc
gagagggactcaggctgtggcagcctctccatctccgagggcatggactacagcacctcc
ctatccaccgacctgtccctgaacaaagagtcaggctctctgtccattaaggactcaaag
ctgtacaacaagaccctcaagcggacacgcaagtttgtggtggacggcgtggaggtgagc
atcaccacctccaagatcatcggtgacgatgagaagaaggatgaggagatgagatttctc
cggcgccaggaactccgagagctccggctgctccagaaggaagaacatcggaaccagacc
cagctgagcaggaagcatgagctacagctagagcagatgcagaaacgctttgaacaagaa
atcaataccaagaagaagtactttgacgtggagctggagaacctggagcgtcagcagaag
cagcaagtggagaagatggagcaagagcatgccgtacgccgtcgggaggaggccaagcgg
atccgcctggaccaggagcgggactacgccaggttccaggaacagttcaaactgatgaag
aaggaggtaaagtccgaagtggagaagcttccccggcagcagcggaaggagaacatgaag
cagaagatggaggagcatgcacagaaaaagcagcttcttgaccaggactttctagccaag
cagaaggatgacctggagctggcaatgaagaggatcacggcggagaacaggcgggagatc
tgtgataaggagcgtgagtgtctcagtaggaagcaggagctccttcgagaccgggaggca
gccctgtgggagatggaggagcaccacctgcaggagagacaccagctggtgaagcagcag
ctcaaagaccagtacttcctgcagcggcacgagctgctgcgcaagcacgagaaggagcgg
gagcagatgcagcgttacaaccagcgcatgatggagcagctgaaggtgcggcagcagcag
gagaaggcacggctgcccaagattcagaggagcgaaggcaagacgcgcatggccatgtac
aagaagagcctccacatcaatggtggcggcagcgcctcggagcagcgcgagaagatcaag
cagttttcccagcaggaggagaagaggcaaaagtcggagcggctgcagcagcagcaaaaa
catgagaaccagatgcgggacatggtggtacagtgcgagagcaacacaaatgagctgcag
cagctgcagaacgaaaaatgtcacctcttggtagagcacgaaacccagaagctgaaggcc
ctggacgagagccataaccagaccctgaaggaatggcgggacaagcttcggccacgcaaa
aaggctctggaagaagagctgaaccagaagaagtgggagcaggagatgttcttcaaactg
agtgaggaagcagagtgcctgaaccctcccaccccaagcaaggccaccaagttcttcccc
cacagctctgcagatgcttcttaa

DBGET integrated database retrieval system