KEGG   Loxodonta africana (African savanna elephant): 100664659
Entry
100664659         CDS       T04351                                 

Gene name
ASIP
Definition
(RefSeq) agouti-signaling protein
  KO
K08725  agouti signaling protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100664659 (ASIP)
SSDB
Motif
Pfam: Agouti Toxin_9
Other DBs
NCBI-GeneID: 100664659
NCBI-ProteinID: XP_003411713
UniProt: G3SVT4
LinkDB
Position
Unknown
AA seq 134 aa
MDVTRLFLASLLVCLYFLIAHSHLELKEKPRDDRSLKSNCSMKLLDFPSVSVVALNKKSK
RILSRKEAEMMKGPSKKKASVKKAARPRPPPPAGCVATRDSCKPPAPACCDPCASCQCRF
FRSACSCRVLSPNC
NT seq 405 nt   +upstreamnt  +downstreamnt
atggatgtcacccgcctgttcctggcctctctgctggtctgcctgtactttctcattgcc
cacagccacctggaactcaaggagaaacccagagatgacaggagcctgaagagcaattgc
tccatgaaactgttggatttcccttctgtctcagtcgtggcactgaacaagaaatccaaa
aggatcctcagcagaaaagaagctgaaatgatgaagggaccttccaagaagaaggcttcg
gtgaagaaggcggcgcggccccgacccccgccgcccgctggctgcgtggccacccgcgac
agctgcaagccgccggcgcctgcctgctgcgacccgtgcgcctcctgccagtgccgcttc
ttccgcagcgcctgctcctgccgcgtgctgagccccaactgctga

DBGET integrated database retrieval system