KEGG   Loxodonta africana (African savanna elephant): 100664710
Entry
100664710         CDS       T04351                                 

Gene name
IGF1
Definition
(RefSeq) insulin-like growth factor I isoform X1
  KO
K05459  insulin-like growth factor 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04114  Oocyte meiosis
lav04115  p53 signaling pathway
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04510  Focal adhesion
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04730  Long-term depression
lav04750  Inflammatory mediator regulation of TRP channels
lav04913  Ovarian steroidogenesis
lav04914  Progesterone-mediated oocyte maturation
lav04935  Growth hormone synthesis, secretion and action
lav04960  Aldosterone-regulated sodium reabsorption
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05205  Proteoglycans in cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05218  Melanoma
lav05224  Breast cancer
lav05410  Hypertrophic cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100664710 (IGF1)
   04014 Ras signaling pathway
    100664710 (IGF1)
   04015 Rap1 signaling pathway
    100664710 (IGF1)
   04066 HIF-1 signaling pathway
    100664710 (IGF1)
   04068 FoxO signaling pathway
    100664710 (IGF1)
   04151 PI3K-Akt signaling pathway
    100664710 (IGF1)
   04152 AMPK signaling pathway
    100664710 (IGF1)
   04150 mTOR signaling pathway
    100664710 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100664710 (IGF1)
   04115 p53 signaling pathway
    100664710 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100664710 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100664710 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100664710 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    100664710 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    100664710 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100664710 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    100664710 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100664710 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    100664710 (IGF1)
   04213 Longevity regulating pathway - multiple species
    100664710 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100664710 (IGF1)
   05202 Transcriptional misregulation in cancer
    100664710 (IGF1)
   05205 Proteoglycans in cancer
    100664710 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    100664710 (IGF1)
   05218 Melanoma
    100664710 (IGF1)
   05215 Prostate cancer
    100664710 (IGF1)
   05224 Breast cancer
    100664710 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100664710 (IGF1)
   05414 Dilated cardiomyopathy
    100664710 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100664710 (IGF1)
   01522 Endocrine resistance
    100664710 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100664710 (IGF1)
Cytokines and growth factors [BR:lav04052]
 Growth factors
  Growth factors (RTK binding)
   100664710 (IGF1)
SSDB
Motif
Pfam: Insulin Paf1
Other DBs
NCBI-GeneID: 100664710
NCBI-ProteinID: XP_003405680
LinkDB
Position
Unknown
AA seq 210 aa
MGKISSLPTQLFKCCFCDFLKVKVHIMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPSKSARS
VRAQRHTDMPKAQKHRPPSTNKKAMKSQRRRKGGPMKHPGGRQNEGAEACQQIRGQKKEQ
RRKAGSRNSEHRGQRGKWTQEVARRQRQGQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtgaaggtgcacatcatgtcctcctcgcacctcttctacctggccctgtgcttgctc
accttcaccagctccgccacagcggggccggagacgctctgcggggctgagttggtggat
gctcttcagttcgtgtgtggagacaggggcttttatttcaacaagcccacagggtacggc
tccagcagtcggcgggcacctcagacgggcatcgtggatgagtgctgcttccggagctgc
gatctgaggaggctggagatgtactgcgcacccctcaagccctccaagtcagctcgctcc
gtccgtgcccagcgccacactgacatgcccaaggctcagaagcatcggcccccatctacc
aacaagaaagcaatgaagtctcagaggagaaggaaaggtgggccaatgaaacacccagga
gggaggcagaatgagggggcagaagcatgtcagcagatcagaggacagaagaaagagcag
agaaggaaggctggaagtagaaactctgaacacagaggccaaagaggaaaatggacgcaa
gaagtagcacgcagacagaggcaagggcaatga

DBGET integrated database retrieval system