KEGG   Loxodonta africana (African savanna elephant): 100664945
Entry
100664945         CDS       T04351                                 

Gene name
RRM2
Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav00240  Pyrimidine metabolism
lav00480  Glutathione metabolism
lav00983  Drug metabolism - other enzymes
lav01100  Metabolic pathways
lav04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100664945 (RRM2)
   00240 Pyrimidine metabolism
    100664945 (RRM2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100664945 (RRM2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100664945 (RRM2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100664945 (RRM2)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     100664945 (RRM2)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    100664945 (RRM2)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 100664945
NCBI-ProteinID: XP_003411931
UniProt: G3SSS7
LinkDB
Position
Unknown
AA seq 386 aa
MLSVRVPLATIDQQQLRLSPMKGLTLADKENTPPSLSSARVLASKAARKIFQEPENTKVP
ASSVEDEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEALKPEE
RYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTY
IKDSKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASI
FWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLLHKPSEQRVKEIIINAVRIEQEF
LTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKVFKVENPFDFMENISLEGKTNFFE
KRVGEYQRMGVMSSPTENSFTLDADF
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgctgtcggtccgtgtcccgctcgccaccatcgaccagcagcagctccggctttctccc
atgaaggggctcaccctggcggacaaagagaacactcccccgtctctcagcagtgcccgc
gtcctggccagcaaggctgcgaggaagatcttccaggagccggagaacactaaggtacct
gcctccagcgtggaagatgaaccactgctgagagaaaatccccgccgctttgtcgtcttt
cctattgaataccatgatatttggcagatgtacaagaaagctgaggcttccttttggaca
gctgaggaggtggatctttccaaggacattcagcactgggaagccctgaagcctgaggag
agatattttatatcacacgttctggctttctttgcagcaagtgatggcatagtgaatgaa
aacctggtggagcgatttagccaagaagttcagattaccgaagcccgctgtttctatggc
ttccaaattgccatggaaaacatacattctgaaatgtatagtctccttattgacacttac
attaaagattccaaggaaagggagtttctcttcaacgccattgaaacgatgccttgtgta
aaaaagaaggcagattgggccttgcgttggattggggacaaagaagctacctatggagag
cgtgttgtagcctttgcagcagtagaagggatcttcttttctggttcttttgcatcgata
ttctggctcaagaaacgaggattaatgcctggcctcacgttctccaatgaacttattagc
agagatgagggtttacactgtgactttgcctgcctcatgttcaaacacctgctacacaaa
ccttcggagcaaagagtcaaagaaataattattaacgctgttaggatagaacaggagttc
cttaccgaggccttgcctgtgaagcttatcggaatgaattgtactttaatgaagcagtac
attgaattcgtggcggacagactaatgctggaactgggttttaacaaggtgttcaaagta
gagaatccatttgactttatggagaacatttcactggaagggaagactaacttcttcgag
aagagagtaggcgagtatcagagaatgggagtgatgtcgagcccaacagagaattctttt
accttggatgccgacttctga

KEGG   Loxodonta africana (African savanna elephant): 100673076
Entry
100673076         CDS       T04351                                 

Gene name
RRM2B
Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2 B
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav00240  Pyrimidine metabolism
lav00480  Glutathione metabolism
lav00983  Drug metabolism - other enzymes
lav01100  Metabolic pathways
lav04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100673076 (RRM2B)
   00240 Pyrimidine metabolism
    100673076 (RRM2B)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100673076 (RRM2B)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100673076 (RRM2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100673076 (RRM2B)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     100673076 (RRM2B)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    100673076 (RRM2B)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 100673076
NCBI-ProteinID: XP_023401440
LinkDB
Position
Unknown
AA seq 332 aa
MYKQAQASFWTAEEVDLSKDLPHWNKLTSDEKYFISHILAFFAASDGIVNENLVERFSQE
VQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALR
WIADRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDF
ACLMFQYLVNRPSEERVREIIVNAVEIEQEFLTEALPVGLIGMNSVLMKQYIEFVADRLL
VELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSDFMLEGDSDISEVLGRKGFDPPNSW
LNSDKENIRGNGREMNDFFPTDKNITIQRLSD
NT seq 999 nt   +upstreamnt  +downstreamnt
atgtataaacaggcacaggcatccttctggacagcagaagaggttgacttatcaaaggat
ctccctcattggaacaagcttacatcagatgagaagtattttatctcccacatcttagcc
ttttttgcagccagtgatggaattgtaaatgaaaacttggtggagcgctttagtcaggag
gtacaggttccagaggcccgctgtttctatggctttcaaattctcatcgagaacgttcac
tcagagatgtacagtttgctaatagacacttacatcagagatcccaagaaaagggaattt
ttatttaatgcaattgaaacaatgccgtatgttaagaaaaaagcagattgggctttgaga
tggatagcagatagaaaatctacttttggggaaagggtggtagcctttgctgctgtagaa
ggaattttcttctccggatcttttgccgctatattctggctaaagaagagaggtcttatg
cctggactcactttttccaatgaactcatcagcagagatgaaggactccattgtgacttt
gcttgcctgatgtttcagtacttagtaaataggccttcagaagaaagggtcagggagatc
attgttaatgctgttgaaattgagcaggagtttttaacagaagccttgccagttggcctc
attggaatgaatagtgttttgatgaaacaatatattgagtttgtagcagacagattactt
gtggaactcggattctcaaaggttttccaggcagaaaatccctttgattttatggaaaac
atttctttagaagggaaaacaaatttctttgaaaaacgagtttcagacttcatgttagaa
ggagattctgatatttctgaggttttaggaaggaaaggatttgatcctccaaattcttgg
cttaattctgataaagaaaatatacgtggaaatggaagagagatgaatgatttttttcct
acagataaaaatataacaattcaaagactttctgattaa

DBGET integrated database retrieval system